UFD1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UFD1_RAT
• UniProt AC: Q9ES53
• Protein Name: Ubiquitin recognition factor in ER-associated degradation protein 1
• Gene Name: Ufd1 {ECO:0000312|RGD:619822}
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 307
• Subcellular Localization: Nucleus . Cytoplasm, cytosol .
• Protein Description: Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures. [PubMed: 10811609 Acts as a negative regulator of type I interferon production via the complex formed with VCP and NPLOC4, which binds to DDX58/RIG-I and recruits RNF125 to promote ubiquitination and degradation of DDX58/RIG-I (By similarity]
• Protein Sequence: MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPMVKKVEEDEAGGRFVAFSGEGQSLRKKGRKP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MFSFNMFD -------CCCCCCCC	5.99	-
62	Phosphorylation	QLSRLNITYPMLFKL HHHHCCCHHHHHEEC	22.09	25575281
63	Phosphorylation	LSRLNITYPMLFKLT HHHCCCHHHHHEECC	5.26	25575281
70	Phosphorylation	YPMLFKLTNKNSDRM HHHHEECCCCCCCCC	44.74	25575281
74	Phosphorylation	FKLTNKNSDRMTHCG EECCCCCCCCCCEEE	28.36	25575281
129	Phosphorylation	YSKFQPQSPDFLDIT EECCCCCCCCCCCCC	32.87	28689409
209	Phosphorylation	RPVQHEESIEGEADH CCCCCCHHCCCCCCC	23.97	25575281
217	Phosphorylation	IEGEADHSGYAGEVG CCCCCCCCCCCCEEE	33.76	25575281
219	Phosphorylation	GEADHSGYAGEVGFR CCCCCCCCCCEEEEE	17.91	25575281
229	Phosphorylation	EVGFRAFSGSGNRLD EEEEEEECCCCCCCC	30.94	25575281
231	Phosphorylation	GFRAFSGSGNRLDGK EEEEECCCCCCCCCC	31.53	25575281
245	Phosphorylation	KKKGVEPSPSPIKPG CCCCCCCCCCCCCCC	25.22	27097102
247	Phosphorylation	KGVEPSPSPIKPGDI CCCCCCCCCCCCCCC	43.53	27097102
294	Phosphorylation	GGRFVAFSGEGQSLR CCEEEEECCCCCHHH	26.63	25403869
299	Phosphorylation	AFSGEGQSLRKKGRK EECCCCCHHHHCCCC	40.78	28689409

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UFD1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UFD1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UFD1_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TERA_RAT	Vcp	physical	10811609
NPL4_RAT	Nploc4	physical	10811609

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.