| UniProt ID | UEVLD_HUMAN | |
|---|---|---|
| UniProt AC | Q8IX04 | |
| Protein Name | Ubiquitin-conjugating enzyme E2 variant 3 | |
| Gene Name | UEVLD {ECO:0000312|EMBL:AAH64566.1} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 471 | |
| Subcellular Localization | ||
| Protein Description | Possible negative regulator of polyubiquitination.. | |
| Protein Sequence | MEFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 (in isoform 6) | Phosphorylation | - | 14.32 | 25262027 | |
| 37 (in isoform 3) | Phosphorylation | - | 14.32 | 25262027 | |
| 38 (in isoform 6) | Phosphorylation | - | 15.69 | 25262027 | |
| 38 (in isoform 3) | Phosphorylation | - | 15.69 | 25262027 | |
| 41 (in isoform 6) | Phosphorylation | - | 16.97 | 25262027 | |
| 41 (in isoform 3) | Phosphorylation | - | 16.97 | 25262027 | |
| 42 (in isoform 6) | Phosphorylation | - | 10.30 | 25262027 | |
| 42 (in isoform 3) | Phosphorylation | - | 10.30 | 25262027 | |
| 45 | Ubiquitination | SMDTYVFKDSSQKDL ECCEEEECCCCCCHH | 46.81 | 21890473 | |
| 45 (in isoform 3) | Phosphorylation | - | 46.81 | 25262027 | |
| 45 (in isoform 6) | Phosphorylation | - | 46.81 | 25262027 | |
| 45 (in isoform 5) | Ubiquitination | - | 46.81 | 21890473 | |
| 45 (in isoform 1) | Ubiquitination | - | 46.81 | 21890473 | |
| 45 (in isoform 2) | Ubiquitination | - | 46.81 | 21890473 | |
| 46 (in isoform 6) | Phosphorylation | - | 41.90 | 25262027 | |
| 46 (in isoform 3) | Phosphorylation | - | 41.90 | 25262027 | |
| 134 (in isoform 4) | Ubiquitination | - | 36.33 | 21906983 | |
| 142 | Phosphorylation | FQEELPMYSLSSSDE HHHHCCCCCCCCCHH | 12.43 | 24114839 | |
| 143 | Phosphorylation | QEELPMYSLSSSDEA HHHCCCCCCCCCHHH | 18.61 | 24114839 | |
| 147 | Phosphorylation | PMYSLSSSDEARQVD CCCCCCCCHHHHHHH | 35.77 | 24114839 | |
| 150 (in isoform 3) | Ubiquitination | - | 16.52 | 21906983 | |
| 158 | Phosphorylation | RQVDLLAYIAKITEG HHHHHHHHHHHHCCC | 11.03 | 29978859 | |
| 167 | Phosphorylation | AKITEGVSDTNSKSW HHHCCCCCCCCCCCH | 49.96 | 25627689 | |
| 169 | Phosphorylation | ITEGVSDTNSKSWAN HCCCCCCCCCCCHHC | 33.61 | 25627689 | |
| 171 | Phosphorylation | EGVSDTNSKSWANHE CCCCCCCCCCHHCCC | 30.11 | 25627689 | |
| 172 (in isoform 2) | Ubiquitination | - | 52.68 | 21890473 | |
| 172 (in isoform 1) | Ubiquitination | - | 52.68 | 21890473 | |
| 172 (in isoform 5) | Ubiquitination | - | 52.68 | 21890473 | |
| 172 | Ubiquitination | GVSDTNSKSWANHEN CCCCCCCCCHHCCCC | 52.68 | 21906983 | |
| 173 | Phosphorylation | VSDTNSKSWANHENK CCCCCCCCHHCCCCC | 31.10 | 29759185 | |
| 180 | Ubiquitination | SWANHENKTVNKITV CHHCCCCCCEEEEEE | 51.36 | - | |
| 181 | Phosphorylation | WANHENKTVNKITVV HHCCCCCCEEEEEEE | 40.67 | - | |
| 186 | Phosphorylation | NKTVNKITVVGGGEL CCCEEEEEEECCCHH | 15.68 | - | |
| 198 | Phosphorylation | GELGIACTLAISAKG CHHHHHHHHHHHHCC | 15.37 | - | |
| 303 (in isoform 4) | Ubiquitination | - | 13.38 | 21906983 | |
| 319 (in isoform 3) | Ubiquitination | - | 4.28 | 21906983 | |
| 323 | Phosphorylation | GIGCNLDSQRLQYII EEECCCCHHHHHHHH | 21.99 | - | |
| 341 (in isoform 1) | Ubiquitination | - | 49.19 | 21890473 | |
| 341 | Ubiquitination | LKAQTSGKEVWVIGE HHHHCCCCEEEEEEE | 49.19 | 2190698 | |
| 341 (in isoform 2) | Ubiquitination | - | 49.19 | 21890473 | |
| 407 | Ubiquitination | SIVNNKKKVHSVSAL HHHCCCCCEEEHHHH | 46.95 | - | |
| 454 | Ubiquitination | KEDTVTEKLQSSASS CCCCHHHHHHHCHHH | 42.32 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UEVLD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UEVLD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UEVLD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RNF4_HUMAN | RNF4 | physical | 19549727 | |
| RN114_HUMAN | RNF114 | physical | 19549727 | |
| TRAF6_HUMAN | TRAF6 | physical | 19549727 | |
| DTX3_HUMAN | DTX3 | physical | 19549727 | |
| LRSM1_HUMAN | LRSAM1 | physical | 19549727 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
