UniProt ID | UCP3_HUMAN | |
---|---|---|
UniProt AC | P55916 | |
Protein Name | Mitochondrial uncoupling protein 3 | |
Gene Name | UCP3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 312 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance.. | |
Protein Sequence | MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
90 | Phosphorylation | AGLQRQMSFASIRIG HHHHHHHCCHHEEEE | 14.88 | 30622161 | |
93 | Phosphorylation | QRQMSFASIRIGLYD HHHHCCHHEEEECCC | 15.47 | 30622161 | |
99 | Phosphorylation | ASIRIGLYDSVKQVY HHEEEECCCCCCEEE | 10.85 | 30622161 | |
101 | O-linked_Glycosylation | IRIGLYDSVKQVYTP EEEECCCCCCEEECC | 20.05 | 30379171 | |
101 | Phosphorylation | IRIGLYDSVKQVYTP EEEECCCCCCEEECC | 20.05 | 30622161 | |
106 | Phosphorylation | YDSVKQVYTPKGADN CCCCCEEECCCCCCC | 18.16 | 30622161 | |
107 | Phosphorylation | DSVKQVYTPKGADNS CCCCEEECCCCCCCC | 21.48 | 30622161 | |
166 | Phosphorylation | YSGTMDAYRTIAREE CCCCHHHHHHHHHHH | 12.20 | - | |
168 | Phosphorylation | GTMDAYRTIAREEGV CCHHHHHHHHHHHCC | 13.30 | - | |
270 | Phosphorylation | MVAQEGPTAFYKGFT HHHCCCCCEECCCCC | 40.01 | - | |
310 | Phosphorylation | KVQMLRESPF----- HHHHHHCCCC----- | 25.77 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UCP3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UCP3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UCP3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
1433B_HUMAN | YWHAB | physical | 10785390 | |
1433Z_HUMAN | YWHAZ | physical | 10785390 | |
1433T_HUMAN | YWHAQ | physical | 10785390 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...