UniProt ID | U1SBP_HUMAN | |
---|---|---|
UniProt AC | Q16560 | |
Protein Name | U11/U12 small nuclear ribonucleoprotein 35 kDa protein | |
Gene Name | SNRNP35 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 246 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
88 | Phosphorylation | RLVRDLVTGFSKGYA HHHHHHHHHCCCCEE | 39.54 | 20068231 | |
91 | Phosphorylation | RDLVTGFSKGYAFIE HHHHHHCCCCEEEEE | 26.90 | 21712546 | |
131 | Phosphorylation | VDYELERTLKGWIPR EEHHHHHHHCCCCCC | 24.36 | - | |
147 | Acetylation | LGGGLGGKKESGQLR CCCCCCCCCCCCCCC | 52.12 | 7681329 | |
148 | Acetylation | GGGLGGKKESGQLRF CCCCCCCCCCCCCCC | 61.46 | 7350231 | |
172 | Sumoylation | PINLPVVKNDLYREG CCCCCCCCCHHHHHH | 45.00 | 28112733 | |
180 | Ubiquitination | NDLYREGKRERRERS CHHHHHHHHHHHHHH | 46.46 | - | |
187 | Phosphorylation | KRERRERSRSRERHW HHHHHHHHHHHHHHH | 29.83 | 20068231 | |
189 | Phosphorylation | ERRERSRSRERHWDS HHHHHHHHHHHHHHH | 39.48 | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of U1SBP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of U1SBP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of U1SBP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
PDCD7_HUMAN | PDCD7 | physical | 28514442 | |
RBM40_HUMAN | RNPC3 | physical | 28514442 | |
SNR48_HUMAN | SNRNP48 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...