dbPTM

U184_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	U184_DROME
UniProt AC	O97420
Protein Name	UPF0184 protein CG14818
Gene Name	CG14818
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	96
Subcellular Localization
Protein Description
Protein Sequence	MSPKNNHDPSSSGDSGNTNVQEADLQEMEDVNNSLDALSCALDAVEQRTDDIMSQLRELLNSNREIRRLIAEENDNAPESGDDNMDGQAGSEAAPK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of U184_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of U184_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of U184_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of U184_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CCD22_DROME	CG9951	physical	14605208
JRA_DROME	Jra	physical	14605208
RLA0_DROME	RpLP0	physical	14605208
ARL8_DROME	Gie	physical	14605208
NOG1_DROME	Non1	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of U184_DROME

Related Literatures of Post-Translational Modification