UniProt ID | TYOBP_HUMAN | |
---|---|---|
UniProt AC | O43914 | |
Protein Name | TYRO protein tyrosine kinase-binding protein | |
Gene Name | TYROBP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 113 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
Protein Description | Non-covalently associates with activating receptors of the CD300 family. Cross-linking of CD300-TYROBP complexes results in cellular activation. Involved for instance in neutrophil activation mediated by integrin.. | |
Protein Sequence | MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
85 | Phosphorylation | ATRKQRITETESPYQ HHHHHHHHCCCCHHH | 38.76 | 27486199 | |
87 | Phosphorylation | RKQRITETESPYQEL HHHHHHCCCCHHHHH | 32.87 | 23532336 | |
89 | Phosphorylation | QRITETESPYQELQG HHHHCCCCHHHHHCC | 36.01 | 28450419 | |
91 | Phosphorylation | ITETESPYQELQGQR HHCCCCHHHHHCCCC | 24.73 | 21082442 | |
99 | Phosphorylation | QELQGQRSDVYSDLN HHHCCCCCHHHHHHC | 24.44 | 28176486 | |
102 | Phosphorylation | QGQRSDVYSDLNTQR CCCCCHHHHHHCCCC | 11.06 | 25587033 | |
103 | Phosphorylation | GQRSDVYSDLNTQRP CCCCHHHHHHCCCCC | 35.16 | 28176486 | |
107 | Phosphorylation | DVYSDLNTQRPYYK- HHHHHHCCCCCCCC- | 33.00 | 24719451 | |
111 | Phosphorylation | DLNTQRPYYK----- HHCCCCCCCC----- | 26.52 | 25587033 | |
112 | Phosphorylation | LNTQRPYYK------ HCCCCCCCC------ | 16.95 | 25587033 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
91 | Y | Phosphorylation | Kinase | SYK | P43405 | GPS |
91 | Y | Phosphorylation | Kinase | SYK | Q15046 | PhosphoELM |
102 | Y | Phosphorylation | Kinase | SYK | P43405 | GPS |
102 | Y | Phosphorylation | Kinase | SYK | Q15046 | PhosphoELM |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TYOBP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TYOBP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SIRB1_HUMAN | SIRPB1 | physical | 10940905 | |
SIRBL_HUMAN | SIRPB1 | physical | 10940905 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00438 | Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL); Nasu-Hakola di | |||||
OMIM Disease | ||||||
221770 | Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale proteomics analysis of the human kinome."; Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.; Mol. Cell. Proteomics 8:1751-1764(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-91, AND MASSSPECTROMETRY. | |
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-91, AND MASSSPECTROMETRY. |