| UniProt ID | TTS1_SCHPO | |
|---|---|---|
| UniProt AC | Q9Y7Z5 | |
| Protein Name | Tetra-spanning protein 1 | |
| Gene Name | tts1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 279 | |
| Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein. Endoplasmic reticulum membrane Multi-pass membrane protein. Nucleus membrane Multi-pass membrane protein. Enriched at the cell equator during mitosis. |
|
| Protein Description | Required for the correct positioning of the cellular division plane by delimiting the actomyosin ring assembly at the cell equator.. | |
| Protein Sequence | MEPKQRVVKPLKERVLPVVKNTQFVWFSGQVIVLISSVLYALQAIPFRSAPPFLFKSAAFGAIVAYAIVLYKTYSPNLTSRASWNKHFFARLMLDDNVQYFILALSMLIDRPILFSLAPYAIYATFHISTYLRSVLLPAIYPNISDAKTASYASRVSNLLNQYTRSQFQPAMQLVASLETFLLFRLFFGVFLRKNSISRLVGYIFFLRMRYTNSHFTRASIKAVSLRMDRLVADNRVPPVIKNAWHTFKTYVSKFGASPVGTAQSRPTASSSTTAPSST | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 49 | Phosphorylation | LQAIPFRSAPPFLFK HHCCCCCCCCCCCCH | 45.57 | 25720772 | |
| 77 | N-linked_Glycosylation | LYKTYSPNLTSRASW HHHHCCCCCCCCCCC | 50.43 | - | |
| 143 | N-linked_Glycosylation | LLPAIYPNISDAKTA HHHHHCCCCCHHHHH | 29.44 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TTS1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TTS1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TTS1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RTN1_SCHPO | rtn1 | physical | 20434336 | |
| RTN1_SCHPO | rtn1 | genetic | 20434336 | |
| YOP1_SCHPO | yop1 | genetic | 20434336 | |
| YH75_SCHPO | scs2 | genetic | 23041194 | |
| YDFC_SCHPO | scs22 | genetic | 23041194 | |
| UBP1_SCHPO | ubp1 | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
