UniProt ID | TSNAX_MOUSE | |
---|---|---|
UniProt AC | Q9QZE7 | |
Protein Name | Translin-associated protein X | |
Gene Name | Tsnax | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 290 | |
Subcellular Localization | Cytoplasm, perinuclear region. Golgi apparatus . Nucleus. Expressed in the cytoplasm in the presence of TSN (By similarity). Accumulate in the Golgi complex of mid-late pachytene spermatocytes.. | |
Protein Description | Acts in combination with TSN as an endonuclease involved in the activation of the RNA-induced silencing complex (RISC). Possible role in spermatogenesis (By similarity).. | |
Protein Sequence | MNGKEGPGGFRKRKHDTFPHNQRREGKDASLSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEEILTESESKLDGVRQKILQVAQELSGEDMHQFHRAVTTGLQEYVEAVSFQHFIKTRSLISMEEINKQLTFTAEDSGKESKTPPAEGQEKQLVTWRLKLTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTDMIDQEESIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | FRKRKHDTFPHNQRR CCCCCCCCCCCCCCC | 38.49 | 27841257 | |
30 | Phosphorylation | RREGKDASLSSPVML CCCCCCCCCCCHHHH | 38.63 | 28833060 | |
32 | Phosphorylation | EGKDASLSSPVMLAF CCCCCCCCCHHHHHH | 30.05 | 25521595 | |
33 | Phosphorylation | GKDASLSSPVMLAFK CCCCCCCCHHHHHHH | 27.14 | 26824392 | |
60 | Phosphorylation | YERLVKLSRDITVES HHHHHHHHCCCCCCC | 23.38 | 23737553 | |
64 | Phosphorylation | VKLSRDITVESKRTI HHHHCCCCCCCCCHH | 23.62 | 23737553 | |
67 | Phosphorylation | SRDITVESKRTIFLL HCCCCCCCCCHHHHH | 24.09 | 23737553 | |
68 | Ubiquitination | RDITVESKRTIFLLH CCCCCCCCCHHHHHE | 39.80 | 22790023 | |
78 | Phosphorylation | IFLLHRITSAPDMEE HHHHEECCCCCCHHH | 20.84 | 28066266 | |
79 | Phosphorylation | FLLHRITSAPDMEEI HHHEECCCCCCHHHH | 35.12 | 28066266 | |
93 | Ubiquitination | ILTESESKLDGVRQK HHHHCHHHHHHHHHH | 46.69 | 22790023 | |
155 | Phosphorylation | INKQLTFTAEDSGKE HHHHHEEEECCCCCC | 24.73 | 26160508 | |
159 | Phosphorylation | LTFTAEDSGKESKTP HEEEECCCCCCCCCC | 43.18 | 26525534 | |
163 | Phosphorylation | AEDSGKESKTPPAEG ECCCCCCCCCCCCCC | 45.36 | 30352176 | |
165 | Phosphorylation | DSGKESKTPPAEGQE CCCCCCCCCCCCCCC | 43.73 | 25521595 | |
173 | Ubiquitination | PPAEGQEKQLVTWRL CCCCCCCCEEEEEEE | 40.83 | 27667366 | |
237 | Phosphorylation | FIGNTGPYEVSKKLY CCCCCCCHHHHHHHH | 30.24 | 17203969 | |
241 | Ubiquitination | TGPYEVSKKLYTLKQ CCCHHHHHHHHHHHH | 52.56 | 22790023 | |
241 | Acetylation | TGPYEVSKKLYTLKQ CCCHHHHHHHHHHHH | 52.56 | 23236377 | |
242 | Ubiquitination | GPYEVSKKLYTLKQS CCHHHHHHHHHHHHH | 38.94 | - | |
244 | Phosphorylation | YEVSKKLYTLKQSLA HHHHHHHHHHHHHHH | 20.93 | - | |
245 | Phosphorylation | EVSKKLYTLKQSLAK HHHHHHHHHHHHHHH | 37.60 | - | |
249 | Phosphorylation | KLYTLKQSLAKVENA HHHHHHHHHHHHHHH | 28.80 | 30635358 | |
252 | Acetylation | TLKQSLAKVENACYA HHHHHHHHHHHHHHH | 56.21 | 22826441 | |
252 | Malonylation | TLKQSLAKVENACYA HHHHHHHHHHHHHHH | 56.21 | 26320211 | |
258 | Phosphorylation | AKVENACYALKVRGS HHHHHHHHHHHCCCC | 16.74 | 30635358 | |
288 | Phosphorylation | DMIDQEESIS----- CCCCCHHHCC----- | 27.64 | 30482847 | |
290 | Phosphorylation | IDQEESIS------- CCCHHHCC------- | 43.37 | 30635358 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSNAX_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSNAX_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSNAX_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TSN_MOUSE | Tsn | physical | 12036294 | |
GOGA3_MOUSE | Golga3 | physical | 12036294 | |
TXIP1_MOUSE | Tsnaxip1 | physical | 12036294 | |
SUN1_MOUSE | Sun1 | physical | 12036294 | |
AKAP9_MOUSE | Akap9 | physical | 12036294 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry."; Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.; J. Proteome Res. 6:250-262(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-237, AND MASSSPECTROMETRY. |