| UniProt ID | TSN33_HUMAN | |
|---|---|---|
| UniProt AC | Q86UF1 | |
| Protein Name | Tetraspanin-33 | |
| Gene Name | TSPAN33 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 283 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
| Protein Description | Plays an important role in normal erythropoiesis (By similarity). It has a role in the differentiation of erythroid progenitors (By similarity). Regulates maturation and trafficking of the transmembrane metalloprotease ADAM10. [PubMed: 26686862 Negatively regulates ligand-induced Notch activity probably by regulating ADAM10 activity] | |
| Protein Sequence | MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Phosphorylation | GEEFSFVSPLVKYLL CCCCCCHHHHHHHHH | 15.54 | 24719451 | |
| 24 | Phosphorylation | FVSPLVKYLLFFFNM CHHHHHHHHHHHHHH | 10.93 | 23663014 | |
| 37 | Phosphorylation | NMLFWVISMVMVAVG HHHHHHHHHHHHHHH | 8.84 | 23663014 | |
| 46 | Phosphorylation | VMVAVGVYARLMKHA HHHHHHHHHHHHHHH | 4.69 | 23663014 | |
| 86 | Phosphorylation | TFCGCIGSLRENICL HHHHHHHHHHHHHHH | 12.35 | 24719451 | |
| 152 | Ubiquitination | NLIDFGQKKFSCCGG HHHHHCCCCCCCCCC | 57.05 | - | |
| 172 | N-linked_Glycosylation | WSQNMYFNCSEDNPS CHHCCEEECCCCCCC | 15.77 | UniProtKB CARBOHYD | |
| 221 | Phosphorylation | EASKVIYTNGCIDKL HHCCCCEECCHHHHH | 17.63 | - | |
| 273 | Phosphorylation | DQIKLQLYNQQHRAD HHHHHHHHCCCCCCC | 9.66 | 27642862 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSN33_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSN33_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSN33_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ADA10_HUMAN | ADAM10 | physical | 23091066 | |
| MOES_HUMAN | MSN | physical | 26186194 | |
| PDZ11_HUMAN | PDZD11 | physical | 26186194 | |
| PKHA7_HUMAN | PLEKHA7 | physical | 26186194 | |
| PKHA7_HUMAN | PLEKHA7 | physical | 28514442 | |
| PDZ11_HUMAN | PDZD11 | physical | 28514442 | |
| EZRI_HUMAN | EZR | physical | 28514442 | |
| MOES_HUMAN | MSN | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
