UniProt ID | TRI59_HUMAN | |
---|---|---|
UniProt AC | Q8IWR1 | |
Protein Name | Tripartite motif-containing protein 59 | |
Gene Name | TRIM59 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 403 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . |
|
Protein Description | May serve as a multifunctional regulator for innate immune signaling pathways.. | |
Protein Sequence | MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQHIITFLSEITLIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
61 | Phosphorylation | LKCPNCRSITEIAPT CCCCCCCCEEEECCC | 35.74 | 27080861 | |
63 | Phosphorylation | CPNCRSITEIAPTGI CCCCCCEEEECCCCH | 23.68 | 27080861 | |
85 | Ubiquitination | ALRAIIEKYQQEDHP HHHHHHHHHHCCCCC | 37.64 | 33845483 | |
171 | Ubiquitination | IEKLKEQKSHSEKMI HHHHHHCCCCCHHHH | 51.75 | 22817900 | |
176 | Ubiquitination | EQKSHSEKMIQGDKE HCCCCCHHHHHCCHH | 44.30 | 22817900 | |
182 | Acetylation | EKMIQGDKEAVLQYF HHHHHCCHHHHHHHH | 55.16 | 23236377 | |
199 | 2-Hydroxyisobutyrylation | LNDTLEQKKKSFLTA HHHHHHHHHHHHHHH | 53.44 | - | |
246 | Phosphorylation | TISLQEESPLKFLEK HHHCCCCCCHHHHHH | 34.48 | 24719451 | |
249 | Ubiquitination | LQEESPLKFLEKVDD CCCCCCHHHHHHHHH | 51.81 | 22817900 | |
253 | Ubiquitination | SPLKFLEKVDDVRQH CCHHHHHHHHHHHHH | 53.78 | 21906983 | |
278 | Phosphorylation | EVQPVEIYPRVSKIL CCCCCEEHHHHHHHH | 3.28 | 21552520 | |
298 | Ubiquitination | RTEIGQIKNVLIPKM CCCHHHHCCEEECCC | 32.87 | 22817900 | |
298 | Acetylation | RTEIGQIKNVLIPKM CCCHHHHCCEEECCC | 32.87 | 21339330 | |
304 | Acetylation | IKNVLIPKMKISPKR HCCEEECCCCCCCCC | 45.92 | 21339330 | |
306 | Acetylation | NVLIPKMKISPKRMS CEEECCCCCCCCCCC | 46.27 | 21339330 | |
308 | Phosphorylation | LIPKMKISPKRMSCS EECCCCCCCCCCCCC | 20.89 | 24719451 | |
310 | Acetylation | PKMKISPKRMSCSWP CCCCCCCCCCCCCCC | 54.68 | 7681813 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
308 | S | Phosphorylation | Kinase | CDK5 | Q00535 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRI59_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRI59_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ECSIT_HUMAN | ECSIT | physical | 22588174 | |
P53_HUMAN | TP53 | physical | 25046164 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...