dbPTM

TRH_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TRH_DROME
UniProt AC	Q24119
Protein Name	Protein trachealess
Gene Name	trh
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	1022
Subcellular Localization	Nucleus .
Protein Description	Transcription factor, master regulator of tracheal cell fates in the embryo, necessary for the development of the salivary gland duct and the posterior spiracles. It may induce a general fate of branched tubular structures of epithelial origin. Heterodimers of tgo/trh are involved in the control of breathless expression..
Protein Sequence	MLPYQAAVAMDYAGYQRQPTPGHPGSHMATMGSLGMPAVPFTHSWMVPTQDLCAMPPYNKMTGHQQPPGAGMHAQQQPLEPGILELRKEKSRDAARSRRGKENYEFYELAKMLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWTREASSSSKLKSAAIRRSPAVDLFEQHQGTHILQSLDGFALAVAADGRFLYISETVSIYLGLSQVEMTGSSIFDYIHQADHSEIADQLGLSLTSGGGGGGGSSSSGGGGGGAGGGMASPTSGASDDGSGTHGTNNPDVAASMTQASTSGYKGYDRSFCVRMKSTLTKRGCHFKSSGYRASDATSNCNNGNNASNNAKNVKNPGSNYSVVLLLCKLRPQYTFSHSRKSQPPLLGMVALAIALPPPSVHEIRLECDMFVTRVNFDLRVAHCEPRVSDLLDYSPEDLVNKSLYSLCHAEDANRLRKSHSDLIEKGQVLTGYYRLMNKSGGYTWLQTCATVVCSTKNADEQNIICVNYVISNRENENMILDCCQLEPSPDSIKHEEGLGNDKSSGSPGGDASGEGNSHLSAGDMKLNSPKTDSEGHSHRGRGRSAAASHGSSMNSLTMIKDSPTPLGVEIDSGVLPTTVATPVPAATPPVQSTKRKRKTKASQHAEDQGQEQVISEQPLPKLPTMEQRDQQPRSRLPSIVDEQPSSAADSAVKDLEQAMSKHLPSPAAVVSVAPPNTDFSADSLLKQQQQQQQLDPNEKSSTIQWIGTPYQQPPAPMPATALLRQLYANRESVIRATARQTPTGVGPGVFYGDQQTGPLPTPPGSESSYENQYLQLHSAASGGHPGGQKTSADAFTNLVSTYGGYHSSIDYHNAMTPPSSVSPRDSNQPGKAAPVLASNGGYDYAPDPLRGQYATSSGDVVPATLPLKPQASYTATMHPSGSTTTEGGVTYSNLDQPQYFAPHSSFHLYHKGSPASGWYSTPSXVVDDQGQVPPSCQDQYHHHHHHHHHQDGSAGSSASQASERWDFVGALGKVARMFFSARKGNPG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
673	Phosphorylation	QPRSRLPSIVDEQPS CCHHCCCCHHCCCCC	39.57	11740943

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
673	S	Phosphorylation	Kinase	AKT1	Q8INB9	Uniprot
710	S	Phosphorylation	Kinase	AKT1	Q8INB9	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TRH_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TRH_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARNT_DROME	tgo	physical	9403694
JING_DROME	jing	genetic	12015288
AKT1_DROME	Akt1	genetic	11740943
FBXW7_DROME	ago	physical	17976568
ARNT_DROME	tgo	physical	9409674

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TRH_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Regulation of Drosophila tracheal system development by proteinkinase B."; Jin J., Anthopoulos N., Wetsch B., Binari R.C., Isaac D.D.,Andrew D.J., Woodgett J.R., Manoukian A.S.; Dev. Cell 1:817-827(2001). Cited for: PHOSPHORYLATION AT SER-673, MUTAGENESIS OF SER-579 AND SER-673, ANDSUBCELLULAR LOCATION.	11740943 [Abstract]