UniProt ID | TR10C_HUMAN | |
---|---|---|
UniProt AC | O14798 | |
Protein Name | Tumor necrosis factor receptor superfamily member 10C | |
Gene Name | TNFRSF10C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 259 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
Protein Description | Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.. | |
Protein Sequence | MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHYLSCTIVGIIVLIVLLIVFV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Phosphorylation | QEEVPQQTVAPQQQR HHCCCCCCCCHHHHC | 17.25 | 24043423 | |
38 | O-linked_Glycosylation | QEEVPQQTVAPQQQR HHCCCCCCCCHHHHC | 17.25 | OGP | |
77 | N-linked_Glycosylation | TEGVDYTNASNNEPS CCCCCCCCCCCCCCC | 34.83 | UniProtKB CARBOHYD | |
99 | Phosphorylation | KSDQKHKSSCTMTRD CCCCCCCCCCCCCCC | 30.30 | 24043423 | |
100 | Phosphorylation | SDQKHKSSCTMTRDT CCCCCCCCCCCCCCC | 20.57 | 24043423 | |
102 | Phosphorylation | QKHKSSCTMTRDTVC CCCCCCCCCCCCCEE | 24.43 | 24043423 | |
104 | Phosphorylation | HKSSCTMTRDTVCQC CCCCCCCCCCCEEEE | 13.77 | 24043423 | |
140 | N-linked_Glycosylation | SGEVQVSNCTSWDDI CCCEEEECCCCHHHC | 33.94 | UniProtKB CARBOHYD | |
156 | N-linked_Glycosylation | CVEEFGANATVETPA CHHHHCCCCEEECCC | 36.20 | UniProtKB CARBOHYD | |
182 | Phosphorylation | PAPAAEETMNTSPGT CCCCHHHHHCCCCCC | 13.76 | 22468782 | |
185 | Phosphorylation | AAEETMNTSPGTPAP CHHHHHCCCCCCCCC | 26.02 | 22468782 | |
204 | Phosphorylation | TMTTSPGTPAPAAEE CCCCCCCCCCCCCHH | 21.47 | 22468782 | |
236 | GPI-anchor | ITSPGTPASSHYLSC EECCCCCCHHHHHHH | 24.41 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TR10C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TR10C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TR10C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
APOA1_HUMAN | APOA1 | physical | 16169070 | |
RFLB_HUMAN | FAM101B | physical | 16169070 | |
ZHX1_HUMAN | ZHX1 | physical | 16169070 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...