UniProt ID | RFLB_HUMAN | |
---|---|---|
UniProt AC | Q8N5W9 | |
Protein Name | Refilin-B | |
Gene Name | RFLNB {ECO:0000312|HGNC:HGNC:28705} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 214 | |
Subcellular Localization | Cytoplasm, cytoskeleton . Colocalizes with FLNA along actin bundle-like structures. | |
Protein Description | Involved in the regulation of the perinuclear actin network and nuclear shape through interaction with filamins. Plays an essential role in the formation of cartilaginous skeletal elements.. | |
Protein Sequence | MVGRLSLQDVPELVDAKKKGDGVLDSPDSGLPPSPSPSHWGLAAGGGGGERAAAPGTLEPDAAAATPAAPSPASLPLAPGCALRLCPLSFGEGVEFDPLPPKEVRYTSLVKYDSERHFIDDVQLPLGLAVASCSQTVTCVPNGTWRNYKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTTTLDYNCRKTLRRFLSSVELEAAELPGSDDLSDEC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MVGRLSLQDVPEL --CCCCCCCCHHHHH | 30266825 | ||
26 | Phosphorylation | KGDGVLDSPDSGLPP CCCCCCCCCCCCCCC | 21712546 | ||
29 | Phosphorylation | GVLDSPDSGLPPSPS CCCCCCCCCCCCCCC | 23401153 | ||
34 | Phosphorylation | PDSGLPPSPSPSHWG CCCCCCCCCCCCCCC | 23401153 | ||
36 | Phosphorylation | SGLPPSPSPSHWGLA CCCCCCCCCCCCCCC | 25850435 | ||
38 | Phosphorylation | LPPSPSPSHWGLAAG CCCCCCCCCCCCCCC | 25850435 | ||
57 | Phosphorylation | ERAAAPGTLEPDAAA CCCCCCCCCCCCHHH | 27251275 | ||
66 | Phosphorylation | EPDAAAATPAAPSPA CCCHHHCCCCCCCCC | 29255136 | ||
71 | Phosphorylation | AATPAAPSPASLPLA HCCCCCCCCCCCCCC | 29255136 | ||
74 | Phosphorylation | PAAPSPASLPLAPGC CCCCCCCCCCCCCCE | 29255136 | ||
106 | Phosphorylation | LPPKEVRYTSLVKYD CCCCCCEEEEEEEEC | 25690035 | ||
112 | Phosphorylation | RYTSLVKYDSERHFI EEEEEEEECCCCCCC | 25690035 | ||
114 | Phosphorylation | TSLVKYDSERHFIDD EEEEEECCCCCCCCC | 25690035 | ||
170 | Phosphorylation | FLSTTIVYPKYPKAV EEEEEEECCCCCCCE | - | ||
172 | Acetylation | STTIVYPKYPKAVYT EEEEECCCCCCCEEE | 8082921 | ||
173 | Phosphorylation | TTIVYPKYPKAVYTT EEEECCCCCCCEEEE | 22461510 | ||
178 | Phosphorylation | PKYPKAVYTTTLDYN CCCCCCEEEECCCHH | 24043423 | ||
179 | Phosphorylation | KYPKAVYTTTLDYNC CCCCCEEEECCCHHH | 24043423 | ||
180 | Phosphorylation | YPKAVYTTTLDYNCR CCCCEEEECCCHHHH | 24043423 | ||
181 | Phosphorylation | PKAVYTTTLDYNCRK CCCEEEECCCHHHHH | 24043423 | ||
184 | Phosphorylation | VYTTTLDYNCRKTLR EEEECCCHHHHHHHH | 24043423 | ||
195 | Phosphorylation | KTLRRFLSSVELEAA HHHHHHHHHCHHHHC | 20736484 | ||
196 | Phosphorylation | TLRRFLSSVELEAAE HHHHHHHHCHHHHCC | 20058876 | ||
207 | Phosphorylation | EAAELPGSDDLSDEC HHCCCCCCCCCCCCC | 29691806 | ||
211 | Phosphorylation | LPGSDDLSDEC---- CCCCCCCCCCC---- | 29691806 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFLB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFLB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFLB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KAT5_HUMAN | KAT5 | physical | 16169070 | |
ZBT16_HUMAN | ZBTB16 | physical | 16169070 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...