TM213_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM213_HUMAN
• UniProt AC: A2RRL7
• Protein Name: Transmembrane protein 213
• Gene Name: TMEM213
• Organism: Homo sapiens (Human).
• Sequence Length: 107
• Subcellular Localization: Membrane ; Single-pass type I membrane protein .
• Protein Sequence: MQRLPAATRATLILSLAFASLHSACSAEASSSNSSSLTAHHPDPGTLEQCLNVDFCPQAARCCRTGVDEYGWIAAAVGWSLWFLTLILLCVDKLMKLTPDEPKDLQA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MQRLPAATRATLILS CCCCCHHHHHHHHHH	23.96	24719451
8 (in isoform 4)	Phosphorylation	-	23.96	22210691
15 (in isoform 4)	Phosphorylation	-	15.62	22210691
20 (in isoform 4)	Phosphorylation	-	21.84	22210691
38 (in isoform 4)	Phosphorylation	-	26.37	22210691
82 (in isoform 4)	Phosphorylation	-	4.81	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM213_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM213_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM213_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MAP2_HUMAN	METAP2	physical	28514442
DCNL5_HUMAN	DCUN1D5	physical	28514442
GLMN_HUMAN	GLMN	physical	28514442
EFNB1_HUMAN	EFNB1	physical	28514442
ALG11_HUMAN	ALG11	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.