TLP3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TLP3_ARATH
• UniProt AC: Q8VY21
• Protein Name: Tubby-like F-box protein 3
• Gene Name: TULP3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 406
• Subcellular Localization: Cell membrane ; Peripheral membrane protein . Plastid . Nucleus, nucleoplasm . Cytoplasm . Phospholipase C activity mediates the release from the plasma membrane and the relocation to plastids, cytoplasm and nucleus.
• Protein Description: Involved in abiotic stress signaling. Tethered to plasma membrane (PM) and probably bound to phosphatidylinositol 4,5-bisphosphate. Abiotic stresses (drought, salt, H(2)O(2)) trigger phospholipase C mediated PM dislogement and plastidial and nucleocytosolic relocation of TULP3..
• Protein Sequence: MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQDTSVPVDAFKQSCWASMPPELLRDVLMRIEQSEDTWPSRKNVVSCAGVCRNWREIVKEIVRVPELSSKLTFPISLKQPGPRGSLVQCYIMRNRSNQTYYLYLGLNQAASNDDGKFLLAAKRFRRPTCTDYIISLNCDDVSRGSNTYIGKLRSNFLGTKFTVYDAQPTNPGTQVTRTRSSRLLSLKQVSPRIPSGNYPVAHISYELNVLGSRGPRRMQCVMDAIPASAVEPGGTAPTQTELVHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLVLKNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAFTICLSSFDTKIACE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	DMRGELGSISRKGFD HHHHCHHCCCCCCCE	29.98	25561503
18	Phosphorylation	RGELGSISRKGFDVR HHCHHCCCCCCCEEE	29.63	30407730
307	Phosphorylation	ESLPSGPSSAAQKEG HHCCCCCCHHHHHHC	35.81	19880383
308	Phosphorylation	SLPSGPSSAAQKEGL HCCCCCCHHHHHHCE	30.66	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TLP3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TLP3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TLP3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKP1A_ARATH	SKP1	physical	23166809
SKP1B_ARATH	ASK2	physical	23166809
SKP1A_ARATH	SKP1	physical	25168737
SKP1B_ARATH	ASK2	physical	25168737
ASK13_ARATH	SK13	physical	25168737

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.