UniProt ID | TIRAP_MOUSE | |
---|---|---|
UniProt AC | Q99JY1 | |
Protein Name | Toll/interleukin-1 receptor domain-containing adapter protein | |
Gene Name | Tirap | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 241 | |
Subcellular Localization | Cytoplasm. Cell membrane. Membrane. Colocalizes with DAB2IP at the plasma membrane.. | |
Protein Description | Adapter involved in the TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response (By similarity). Positively regulates the production of TNF-alpha and interleukin-6 (By similarity).. | |
Protein Sequence | MASSSSVPASSTPSKKPRDKIADWFRQALLKKPKKMPISQESHLYDGSQTATQDGLSPSSCSSPPSHSSPESRSSPSSCSSGMSPTSPPTHVDSSSSSSGRWSKDYDVCVCHSEEDLEAAQELVSYLEGSQASLRCFLQLRDAAPGGAIVSELCQALSRSHCRALLITPGFLRDPWCKYQMLQALTEAPASEGCTIPLLSGLSRAAYPPELRFMYYVDGRGKDGGFYQVKEAVIHYLETLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MASSSSVPAS -----CCCCCCCCCC | 29.47 | 30635358 | |
4 | Phosphorylation | ----MASSSSVPASS ----CCCCCCCCCCC | 19.66 | 30635358 | |
5 | Phosphorylation | ---MASSSSVPASST ---CCCCCCCCCCCC | 32.62 | 30635358 | |
6 | Phosphorylation | --MASSSSVPASSTP --CCCCCCCCCCCCC | 33.78 | 30635358 | |
10 | Phosphorylation | SSSSVPASSTPSKKP CCCCCCCCCCCCCCC | 28.77 | 30635358 | |
11 | Phosphorylation | SSSVPASSTPSKKPR CCCCCCCCCCCCCCH | 46.58 | 30635358 | |
12 | Phosphorylation | SSVPASSTPSKKPRD CCCCCCCCCCCCCHH | 29.14 | 30635358 | |
14 | Phosphorylation | VPASSTPSKKPRDKI CCCCCCCCCCCHHHH | 54.09 | 30635358 | |
74 | Phosphorylation | HSSPESRSSPSSCSS CCCCCCCCCCCCCCC | 56.74 | 29472430 | |
75 | Phosphorylation | SSPESRSSPSSCSSG CCCCCCCCCCCCCCC | 27.91 | 29472430 | |
77 | Phosphorylation | PESRSSPSSCSSGMS CCCCCCCCCCCCCCC | 46.02 | 29472430 | |
78 | Phosphorylation | ESRSSPSSCSSGMSP CCCCCCCCCCCCCCC | 22.77 | 29472430 | |
86 | Phosphorylation | CSSGMSPTSPPTHVD CCCCCCCCCCCCCCC | 46.70 | - | |
90 | Phosphorylation | MSPTSPPTHVDSSSS CCCCCCCCCCCCCCC | 37.60 | - | |
99 | Phosphorylation | VDSSSSSSGRWSKDY CCCCCCCCCCCCCCE | 34.03 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIRAP_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIRAP_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIRAP_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MYD88_MOUSE | Myd88 | physical | 19378012 | |
TNFL9_MOUSE | Tnfsf9 | physical | 24084649 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...