UniProt ID | TIAF1_HUMAN | |
---|---|---|
UniProt AC | O95411 | |
Protein Name | TGFB1-induced anti-apoptotic factor 1 | |
Gene Name | TIAF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 115 | |
Subcellular Localization | Nucleus . | |
Protein Description | Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.. | |
Protein Sequence | MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSPSSPFR ------CCCCCCCHH | 51.46 | 30257219 | |
3 | Phosphorylation | -----MSSPSSPFRE -----CCCCCCCHHH | 27.74 | 30257219 | |
5 | Phosphorylation | ---MSSPSSPFREQS ---CCCCCCCHHHHC | 53.22 | 28787133 | |
6 | Phosphorylation | --MSSPSSPFREQSF --CCCCCCCHHHHCC | 31.29 | 22798277 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIAF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIAF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIAF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JAK3_HUMAN | JAK3 | physical | 10733938 | |
TRIB3_HUMAN | TRIB3 | physical | 18276110 | |
TIAF1_HUMAN | TIAF1 | physical | 22534828 | |
SMAD4_HUMAN | SMAD4 | physical | 22534828 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...