TIAF1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TIAF1_HUMAN
• UniProt AC: O95411
• Protein Name: TGFB1-induced anti-apoptotic factor 1
• Gene Name: TIAF1
• Organism: Homo sapiens (Human).
• Sequence Length: 115
• Subcellular Localization: Nucleus .
• Protein Description: Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation..
• Protein Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSSPSSPFR ------CCCCCCCHH	51.46	30257219
3	Phosphorylation	-----MSSPSSPFRE -----CCCCCCCHHH	27.74	30257219
5	Phosphorylation	---MSSPSSPFREQS ---CCCCCCCHHHHC	53.22	28787133
6	Phosphorylation	--MSSPSSPFREQSF --CCCCCCCHHHHCC	31.29	22798277

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TIAF1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TIAF1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TIAF1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
JAK3_HUMAN	JAK3	physical	10733938
TRIB3_HUMAN	TRIB3	physical	18276110
TIAF1_HUMAN	TIAF1	physical	22534828
SMAD4_HUMAN	SMAD4	physical	22534828

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.