UniProt ID | SZRD1_HUMAN | |
---|---|---|
UniProt AC | Q7Z422 | |
Protein Name | SUZ domain-containing protein 1 | |
Gene Name | SZRD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 152 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEDEEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSNGVVSSPNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEDEEVAE -------CCHHHHHH | 19413330 | ||
9 | Phosphorylation | EDEEVAESWEEAADS CHHHHHHHHHHHHHH | 28348404 | ||
13 (in isoform 4) | Phosphorylation | - | - | ||
17 (in isoform 2) | Phosphorylation | - | 29743597 | ||
18 (in isoform 4) | Phosphorylation | - | 29116813 | ||
19 (in isoform 2) | Phosphorylation | - | 29743597 | ||
19 (in isoform 3) | Phosphorylation | - | 22496350 | ||
20 (in isoform 4) | Phosphorylation | - | 29116813 | ||
21 (in isoform 3) | Phosphorylation | - | 22496350 | ||
34 | Phosphorylation | LKITQKESRKSKSPP HCCCHHHHHCCCCCC | 24719451 | ||
37 | Phosphorylation | TQKESRKSKSPPKVP CHHHHHCCCCCCCCC | 23927012 | ||
38 (in isoform 5) | Phosphorylation | - | 25849741 | ||
39 | Phosphorylation | KESRKSKSPPKVPIV HHHHCCCCCCCCCEE | 29255136 | ||
51 | Phosphorylation | PIVIQDDSLPAGPPP CEEECCCCCCCCCCC | 22167270 | ||
67 | Phosphorylation | IRILKRPTSNGVVSS EEEEECCCCCCCCCC | 30266825 | ||
68 | Phosphorylation | RILKRPTSNGVVSSP EEEECCCCCCCCCCC | 30266825 | ||
73 | Phosphorylation | PTSNGVVSSPNSTSR CCCCCCCCCCCCCCC | 25159151 | ||
73 | O-linked_Glycosylation | PTSNGVVSSPNSTSR CCCCCCCCCCCCCCC | 31373491 | ||
74 | Phosphorylation | TSNGVVSSPNSTSRP CCCCCCCCCCCCCCC | 25159151 | ||
77 | Phosphorylation | GVVSSPNSTSRPTLP CCCCCCCCCCCCCCC | 25159151 | ||
78 | Phosphorylation | VVSSPNSTSRPTLPV CCCCCCCCCCCCCCH | 21712546 | ||
79 | Phosphorylation | VSSPNSTSRPTLPVK CCCCCCCCCCCCCHH | 21712546 | ||
82 | Phosphorylation | PNSTSRPTLPVKSLA CCCCCCCCCCHHHHH | 22199227 | ||
95 | Phosphorylation | LAQREAEYAEARKRI HHHHHHHHHHHHHHH | 28796482 | ||
104 | Phosphorylation | EARKRILGSASPEEE HHHHHHHCCCCCHHH | 32142685 | ||
105 | Phosphorylation | ARKRILGSASPEEEQ HHHHHHCCCCCHHHH | 29255136 | ||
106 | Phosphorylation | RKRILGSASPEEEQE HHHHHCCCCCHHHHC | 33259812 | ||
107 | O-linked_Glycosylation | KRILGSASPEEEQEK HHHHCCCCCHHHHCC | OGP | ||
107 | Phosphorylation | KRILGSASPEEEQEK HHHHCCCCCHHHHCC | 29255136 | ||
113 | Ubiquitination | ASPEEEQEKPILDRP CCCHHHHCCCCCCCC | 29967540 | ||
114 | Ubiquitination | SPEEEQEKPILDRPT CCHHHHCCCCCCCCC | 29967540 | ||
121 | Phosphorylation | KPILDRPTRISQPED CCCCCCCCCCCCCCC | 25159151 | ||
121 | O-linked_Glycosylation | KPILDRPTRISQPED CCCCCCCCCCCCCCC | OGP | ||
124 | Phosphorylation | LDRPTRISQPEDSRQ CCCCCCCCCCCCCCC | 21815630 | ||
129 | Phosphorylation | RISQPEDSRQPNNVI CCCCCCCCCCCCCCC | 21712546 | ||
148 | Ubiquitination | GPDGSQGFKQRR--- CCCCCCCCCCCC--- | 24816145 | ||
149 | Ubiquitination | PDGSQGFKQRR---- CCCCCCCCCCC---- | 24816145 | ||
149 | Methylation | PDGSQGFKQRR---- CCCCCCCCCCC---- | 115980257 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SZRD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SZRD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SZRD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MTMR2_HUMAN | MTMR2 | physical | 22863883 | |
5NTC_HUMAN | NT5C2 | physical | 22863883 | |
SRP14_HUMAN | SRP14 | physical | 22863883 | |
SRP09_HUMAN | SRP9 | physical | 22863883 | |
ZPR1_HUMAN | ZPR1 | physical | 22863883 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...