STX2_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: STX2_RAT
• UniProt AC: P50279
• Protein Name: Syntaxin-2
• Gene Name: Stx2
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 290
• Subcellular Localization: Membrane; Single-pass type IV membrane protein.
• Protein Description: Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm..
• Protein Sequence: MRDRLPDLTACRKSDDGDNAVIITVEKDHFMDAFFHQVEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKAIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDEELEEMLESGKPSIFISDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARRKKWIIAAVVVAVIAVLALIIGLTVGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	DLTACRKSDDGDNAV CCCCEECCCCCCCEE	22.91	29779826

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of STX2_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of STX2_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of STX2_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SNP25_MOUSE	Snap25	physical	7768895
STXB1_RAT	Stxbp1	physical	7768895
STXB2_RAT	Stxbp2	physical	7768895
STXB1_RAT	Stxbp1	physical	8996080

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.