| UniProt ID | STAP2_HUMAN | |
|---|---|---|
| UniProt AC | Q9UGK3 | |
| Protein Name | Signal-transducing adaptor protein 2 | |
| Gene Name | STAP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 403 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Substrate of protein kinase PTK6. May play a regulatory role in the acute-phase response in systemic inflammation and may modulate STAT3 activity.. | |
| Protein Sequence | MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Phosphorylation | KGVLPSHYYESFLEK CCCCCHHHHHHHHHH | 17.17 | 28152594 | |
| 22 | Phosphorylation | GVLPSHYYESFLEKK CCCCHHHHHHHHHHH | 10.32 | 12540842 | |
| 24 | Phosphorylation | LPSHYYESFLEKKGP CCHHHHHHHHHHHCC | 21.00 | 28857561 | |
| 72 | Phosphorylation | LGAFEKLTDEIPWGS CCHHHHHCCCCCCCC | 42.53 | 30266825 | |
| 79 | Phosphorylation | TDEIPWGSSRDPGTH CCCCCCCCCCCCCCC | 20.52 | 30266825 | |
| 80 | Phosphorylation | DEIPWGSSRDPGTHF CCCCCCCCCCCCCCE | 36.44 | 30266825 | |
| 191 | Phosphorylation | ADGVSVTTRQMHNGT CCCEEEEEEEEECCE | 19.42 | - | |
| 204 | Phosphorylation | GTHVVRHYKVKREGP CEEEEEEEEECCCCC | 13.60 | - | |
| 250 | Phosphorylation | PFLLDEDYEKVLGYV HHHCCCCHHHHHCCE | 18.66 | 17368569 | |
| 256 | Phosphorylation | DYEKVLGYVEADKEN CHHHHHCCEEECCCC | 7.31 | 26074081 | |
| 272 | Phosphorylation | ENVWVAPSAPGPGPA CEEEECCCCCCCCCC | 37.04 | 22199227 | |
| 282 | Phosphorylation | GPGPAPCTGGPKPLS CCCCCCCCCCCCCCC | 44.08 | 22199227 | |
| 289 | Phosphorylation | TGGPKPLSPASSQDK CCCCCCCCCCCCCCC | 27.26 | 25849741 | |
| 292 | Phosphorylation | PKPLSPASSQDKLPP CCCCCCCCCCCCCCC | 31.73 | 22199227 | |
| 293 | Phosphorylation | KPLSPASSQDKLPPL CCCCCCCCCCCCCCC | 44.50 | 25849741 | |
| 310 | Phosphorylation | LPNQEENYVTPIGDG CCCCCCCCCCCCCCC | 14.69 | 12540842 | |
| 322 | Phosphorylation | GDGPAVDYENQDVAS CCCCCCCCCCCCCCC | 15.35 | 12540842 | |
| 329 | Phosphorylation | YENQDVASSSWPVIL CCCCCCCCCCCCEEE | 25.42 | 27642862 | |
| 337 | Ubiquitination | SSWPVILKPKKLPKP CCCCEEECCCCCCCC | 43.60 | - | |
| 388 | Phosphorylation | TAGLADMTAELQKKL CCCHHHHHHHHHHHH | 19.96 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 22 | Y | Phosphorylation | Kinase | JAK2 | O60674 | PSP |
| 22 | Y | Phosphorylation | Kinase | SRC | P12931 | Uniprot |
| 250 | Y | Phosphorylation | Kinase | JAK2 | O60674 | PSP |
| 250 | Y | Phosphorylation | Kinase | BRK | Q13882 | PSP |
| 250 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
| 310 | Y | Phosphorylation | Kinase | JAK2 | O60674 | PSP |
| 322 | Y | Phosphorylation | Kinase | JAK2 | O60674 | PSP |
| 322 | Y | Phosphorylation | Kinase | SRC | P12931 | Uniprot |
| - | K | Ubiquitination | E3 ubiquitin ligase | CBL | P22681 | PMID:19401194 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STAP2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STAP2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PTK6_HUMAN | PTK6 | physical | 10980601 | |
| CBL_HUMAN | CBL | physical | 19401194 | |
| FAK1_HUMAN | PTK2 | physical | 17675501 | |
| CSF1R_HUMAN | CSF1R | physical | 17512498 | |
| MYD88_HUMAN | MYD88 | physical | 16365431 | |
| IKKB_HUMAN | IKBKB | physical | 16365431 | |
| IKKA_HUMAN | CHUK | physical | 16365431 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "STAP-2 is phosphorylated at tyrosine-250 by Brk and modulates Brk-mediated STAT3 activation."; Ikeda O., Miyasaka Y., Sekine Y., Mizushima A., Muromoto R., Nanbo A.,Yoshimura A., Matsuda T.; Biochem. Biophys. Res. Commun. 384:71-75(2009). Cited for: PHOSPHORYLATION AT TYR-250 BY PTK6, AND INTERACTION WITH PTK6. | |
| "STAP-2/BKS, an adaptor/docking protein, modulates STAT3 activation inacute-phase response through its YXXQ motif."; Minoguchi M., Minoguchi S., Aki D., Joo A., Yamamoto T., Yumioka T.,Matsuda T., Yoshimura A.; J. Biol. Chem. 278:11182-11189(2003). Cited for: TISSUE SPECIFICITY, PHOSPHORYLATION AT TYR-22; TYR-250; TYR-310 ANDTYR-322, AND MUTAGENESIS OF TYR-22; TYR-250; TYR-310 AND TYR-322. | |
