UniProt ID | SRX1_SCHPO | |
---|---|---|
UniProt AC | Q9URV9 | |
Protein Name | Sulfiredoxin | |
Gene Name | srx1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 124 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in a peroxiredoxin. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase.. | |
Protein Sequence | MTSIHTGSNNNIVELDMSELIRPIPPVLDMNKVNSMMETMTGKTPPASCGLTSEDLEAGELPPVDVLTFKKSGKPYYFAFGGCHRLRAHDEAGRKKVRCKLVNCSPNTLRLYLGASANKFLDSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTSIHTGSN ------CCEEECCCC | 36.07 | 21712547 | |
105 | Phosphorylation | RCKLVNCSPNTLRLY EEEEEECCCCCCHHH | 18.91 | 28889911 | |
108 | Phosphorylation | LVNCSPNTLRLYLGA EEECCCCCCHHHEEH | 19.35 | 29996109 | |
123 | Phosphorylation | SANKFLDSD------ HHHHHHCCC------ | 47.57 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRX1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRX1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRX1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TPX1_SCHPO | tpx1 | physical | 15824112 | |
YI81_SCHPO | SPAPJ695.01c | genetic | 22681890 | |
PDS5_SCHPO | pds5 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...