SRX1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SRX1_SCHPO
• UniProt AC: Q9URV9
• Protein Name: Sulfiredoxin
• Gene Name: srx1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 124
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in a peroxiredoxin. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase..
• Protein Sequence: MTSIHTGSNNNIVELDMSELIRPIPPVLDMNKVNSMMETMTGKTPPASCGLTSEDLEAGELPPVDVLTFKKSGKPYYFAFGGCHRLRAHDEAGRKKVRCKLVNCSPNTLRLYLGASANKFLDSD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTSIHTGSN ------CCEEECCCC	36.07	21712547
105	Phosphorylation	RCKLVNCSPNTLRLY EEEEEECCCCCCHHH	18.91	28889911
108	Phosphorylation	LVNCSPNTLRLYLGA EEECCCCCCHHHEEH	19.35	29996109
123	Phosphorylation	SANKFLDSD------ HHHHHHCCC------	47.57	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SRX1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SRX1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SRX1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TPX1_SCHPO	tpx1	physical	15824112
YI81_SCHPO	SPAPJ695.01c	genetic	22681890
PDS5_SCHPO	pds5	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.