| UniProt ID | SRA_DROME | |
|---|---|---|
| UniProt AC | Q9XZL8 | |
| Protein Name | Protein sarah | |
| Gene Name | sra | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 292 | |
| Subcellular Localization | ||
| Protein Description | Required for elongation of meiosis I spindle. Critical for ovulation, meiotic progression in oocytes and female courtship behavior, including their postmating changes. Regulates female meiosis by controlling calcineurin activity in the germline. Has a role in calcium signaling during egg activation; bcd mRNA polyadenylation and translation in the oocyte.. | |
| Protein Sequence | MSDAAKSNNNASADAPDPTTPDATGEADAANAATPTTPRGNHNNNNSANGRSKNKLKSTQNSSGGGSIDKLSPDQDIFINAADGLPNQHPSLPKEGDVDSDTEPEVDADSFDDLPTSIIVTNIHSEVFANPELKHAMEELFRTFSESATFQWLRSFRRLRVNYDNAIAAANARIKLHQYEFNKKTVITCYFAQPVTPVSNKNLQPPAPVKQFLISPPASPPAGWEPREEGEPLVNHDLLAALASLTPGESHELHPQSEDQPAIIVHTAMLAETGPGLQVKAPIVQTKCPERA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 58 | Phosphorylation | RSKNKLKSTQNSSGG CCCCCCCCCCCCCCC | 45.74 | 27794539 | |
| 59 | Phosphorylation | SKNKLKSTQNSSGGG CCCCCCCCCCCCCCC | 30.13 | 27794539 | |
| 62 | Phosphorylation | KLKSTQNSSGGGSID CCCCCCCCCCCCCCC | 22.12 | 21082442 | |
| 63 | Phosphorylation | LKSTQNSSGGGSIDK CCCCCCCCCCCCCCC | 49.35 | 27794539 | |
| 67 | Phosphorylation | QNSSGGGSIDKLSPD CCCCCCCCCCCCCCC | 30.78 | 19060867 | |
| 72 | Phosphorylation | GGSIDKLSPDQDIFI CCCCCCCCCCCCEEE | 31.97 | 22421435 | |
| 100 | Phosphorylation | PKEGDVDSDTEPEVD CCCCCCCCCCCCCCC | 46.40 | 19429919 | |
| 102 | Phosphorylation | EGDVDSDTEPEVDAD CCCCCCCCCCCCCHH | 58.34 | 19429919 | |
| 196 | Phosphorylation | CYFAQPVTPVSNKNL EEECCCCCCCCCCCC | 25.34 | 25749252 | |
| 215 | Phosphorylation | PVKQFLISPPASPPA CCEEEEECCCCCCCC | 27.29 | 19429919 | |
| 219 | Phosphorylation | FLISPPASPPAGWEP EEECCCCCCCCCCCC | 36.87 | 19429919 | |
| 246 | Phosphorylation | LAALASLTPGESHEL HHHHHHCCCCCCCCC | 27.10 | 22421435 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRA_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRA_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRA_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PP2B2_DROME | Pp2B-14D | genetic | 21900555 | |
| PP2B2_DROME | Pp2B-14D | genetic | 24086147 | |
| DIAP1_DROME | th | genetic | 26659252 | |
| PP2B3_DROME | CanA-14F | genetic | 21900555 | |
| ADT_DROME | sesB | physical | 16222229 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
