| UniProt ID | SPY4_MOUSE | |
|---|---|---|
| UniProt AC | Q9WTP2 | |
| Protein Name | Protein sprouty homolog 4 | |
| Gene Name | Spry4 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 300 | |
| Subcellular Localization |
Cytoplasm. Membrane Peripheral membrane protein. Found in the cytoplasm in unstimulated cells but is translocated to the membrane ruffles in cells stimulated with EGF (epidermal growth factor). |
|
| Protein Description | Suppresses the insulin receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras. Probably impairs the formation of GTP-Ras (By similarity). Inhibits Ras-independent, but not Ras-dependent, activation of RAF1 (By similarity).. | |
| Protein Sequence | MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMKTSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDTKTSRSDKPF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEPPVPQS -------CCCCCCCC | 18.41 | - | |
| 46 | Phosphorylation | LPIDQMKTSHVENDY EEHHHHCCCCCCCCC | 20.79 | 18846507 | |
| 47 | Phosphorylation | PIDQMKTSHVENDYI EHHHHCCCCCCCCCC | 21.73 | 18846507 | |
| 53 | Phosphorylation | TSHVENDYIDNPSLA CCCCCCCCCCCCCCC | 23.04 | 26032504 | |
| 58 | Phosphorylation | NDYIDNPSLAPATGP CCCCCCCCCCCCCCC | 43.34 | 18846507 | |
| 63 | Phosphorylation | NPSLAPATGPKRPRG CCCCCCCCCCCCCCC | 53.62 | 18846507 | |
| 78 | Phosphorylation | GPPELAPTPARCDQD CCCCCCCCCCCCCCC | 24.79 | 28059163 | |
| 126 | Phosphorylation | PPVAEQASPRAVRLQ CCHHHHCCCCCEECC | 18.02 | 25521595 | |
| 277 | Ubiquitination | RRPGCRCKHTNSVIC CCCCCCCCCCCCEEE | 33.83 | - | |
| 279 | Phosphorylation | PGCRCKHTNSVICKA CCCCCCCCCCEEEEE | 18.06 | 23984901 | |
| 281 | Phosphorylation | CRCKHTNSVICKAAS CCCCCCCCEEEEECC | 17.64 | 30352176 | |
| 285 | Ubiquitination | HTNSVICKAASGDTK CCCCEEEEECCCCCC | 35.54 | - | |
| 293 | Phosphorylation | AASGDTKTSRSDKPF ECCCCCCCCCCCCCC | 31.31 | - | |
| 294 | Phosphorylation | ASGDTKTSRSDKPF- CCCCCCCCCCCCCC- | 31.20 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPY4_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPY4_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPY4_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SIAH2_MOUSE | Siah2 | physical | 16888801 | |
| SPY4_MOUSE | Spry4 | physical | 16339969 | |
| SOS1_MOUSE | Sos1 | physical | 16339969 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...