UniProt ID | SPY4_MOUSE | |
---|---|---|
UniProt AC | Q9WTP2 | |
Protein Name | Protein sprouty homolog 4 | |
Gene Name | Spry4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 300 | |
Subcellular Localization |
Cytoplasm. Membrane Peripheral membrane protein. Found in the cytoplasm in unstimulated cells but is translocated to the membrane ruffles in cells stimulated with EGF (epidermal growth factor). |
|
Protein Description | Suppresses the insulin receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras. Probably impairs the formation of GTP-Ras (By similarity). Inhibits Ras-independent, but not Ras-dependent, activation of RAF1 (By similarity).. | |
Protein Sequence | MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMKTSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDTKTSRSDKPF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEPPVPQS -------CCCCCCCC | 18.41 | - | |
46 | Phosphorylation | LPIDQMKTSHVENDY EEHHHHCCCCCCCCC | 20.79 | 18846507 | |
47 | Phosphorylation | PIDQMKTSHVENDYI EHHHHCCCCCCCCCC | 21.73 | 18846507 | |
53 | Phosphorylation | TSHVENDYIDNPSLA CCCCCCCCCCCCCCC | 23.04 | 26032504 | |
58 | Phosphorylation | NDYIDNPSLAPATGP CCCCCCCCCCCCCCC | 43.34 | 18846507 | |
63 | Phosphorylation | NPSLAPATGPKRPRG CCCCCCCCCCCCCCC | 53.62 | 18846507 | |
78 | Phosphorylation | GPPELAPTPARCDQD CCCCCCCCCCCCCCC | 24.79 | 28059163 | |
126 | Phosphorylation | PPVAEQASPRAVRLQ CCHHHHCCCCCEECC | 18.02 | 25521595 | |
277 | Ubiquitination | RRPGCRCKHTNSVIC CCCCCCCCCCCCEEE | 33.83 | - | |
279 | Phosphorylation | PGCRCKHTNSVICKA CCCCCCCCCCEEEEE | 18.06 | 23984901 | |
281 | Phosphorylation | CRCKHTNSVICKAAS CCCCCCCCEEEEECC | 17.64 | 30352176 | |
285 | Ubiquitination | HTNSVICKAASGDTK CCCCEEEEECCCCCC | 35.54 | - | |
293 | Phosphorylation | AASGDTKTSRSDKPF ECCCCCCCCCCCCCC | 31.31 | - | |
294 | Phosphorylation | ASGDTKTSRSDKPF- CCCCCCCCCCCCCC- | 31.20 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPY4_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPY4_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPY4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SIAH2_MOUSE | Siah2 | physical | 16888801 | |
SPY4_MOUSE | Spry4 | physical | 16339969 | |
SOS1_MOUSE | Sos1 | physical | 16339969 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...