UniProt ID | SIAH2_MOUSE | |
---|---|---|
UniProt AC | Q06986 | |
Protein Name | E3 ubiquitin-protein ligase SIAH2 | |
Gene Name | Siah2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 325 | |
Subcellular Localization | Cytoplasm . Nucleus . Predominantly cytoplasmic. Partially nuclear. | |
Protein Description | E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. [PubMed: 11257006] | |
Protein Sequence | MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGADPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MSRPSSTGPSANK --CCCCCCCCCCCCC | 39.81 | 24719451 | |
16 | Phosphorylation | PSANKPCSKQPPPPQ CCCCCCCCCCCCCCC | 42.74 | - | |
24 | Phosphorylation | KQPPPPQTPHAPSPA CCCCCCCCCCCCCCC | 23.86 | 17003045 | |
29 | Phosphorylation | PQTPHAPSPAAPPAA CCCCCCCCCCCCCCE | 28.14 | 17003045 | |
69 | Phosphorylation | GGGADPVSPQHHELT CCCCCCCCCCHHHHH | 25.00 | - | |
120 | Phosphorylation | PTCRGALTPSIRNLA CCCCCCCCHHHHHHH | 17.92 | 25338131 | |
122 | Phosphorylation | CRGALTPSIRNLAME CCCCCCHHHHHHHHH | 29.01 | 25338131 | |
175 | Phosphorylation | SCPCPGASCKWQGSL CCCCCCCCCCCCCHH | 23.34 | 26643407 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
16 | S | Phosphorylation | Kinase | DYRK2 | Q5U4C9 | Uniprot |
24 | T | Phosphorylation | Kinase | MAPK14 | Q16539 | GPS |
24 | T | Phosphorylation | Kinase | MAPK14 | P47811 | Uniprot |
29 | S | Phosphorylation | Kinase | DYRK2 | Q5U4C9 | Uniprot |
29 | S | Phosphorylation | Kinase | MAPK14 | Q16539 | GPS |
29 | S | Phosphorylation | Kinase | MAPK14 | P47811 | Uniprot |
69 | S | Phosphorylation | Kinase | DYRK2 | Q5U4C9 | Uniprot |
120 | T | Phosphorylation | Kinase | DYRK2 | Q5U4C9 | Uniprot |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIAH2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PPARG_MOUSE | Pparg | physical | 22294748 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...