dbPTM

SIAH2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SIAH2_MOUSE
UniProt AC	Q06986
Protein Name	E3 ubiquitin-protein ligase SIAH2
Gene Name	Siah2
Organism	Mus musculus (Mouse).
Sequence Length	325
Subcellular Localization	Cytoplasm . Nucleus . Predominantly cytoplasmic. Partially nuclear.
Protein Description	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. [PubMed: 11257006]
Protein Sequence	MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGADPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MSRPSSTGPSANK --CCCCCCCCCCCCC	39.81	24719451
16	Phosphorylation	PSANKPCSKQPPPPQ CCCCCCCCCCCCCCC	42.74	-
24	Phosphorylation	KQPPPPQTPHAPSPA CCCCCCCCCCCCCCC	23.86	17003045
29	Phosphorylation	PQTPHAPSPAAPPAA CCCCCCCCCCCCCCE	28.14	17003045
69	Phosphorylation	GGGADPVSPQHHELT CCCCCCCCCCHHHHH	25.00	-
120	Phosphorylation	PTCRGALTPSIRNLA CCCCCCCCHHHHHHH	17.92	25338131
122	Phosphorylation	CRGALTPSIRNLAME CCCCCCHHHHHHHHH	29.01	25338131
175	Phosphorylation	SCPCPGASCKWQGSL CCCCCCCCCCCCCHH	23.34	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
16	S	Phosphorylation	Kinase	DYRK2	Q5U4C9	Uniprot
24	T	Phosphorylation	Kinase	MAPK14	Q16539	GPS
24	T	Phosphorylation	Kinase	MAPK14	P47811	Uniprot
29	S	Phosphorylation	Kinase	DYRK2	Q5U4C9	Uniprot
29	S	Phosphorylation	Kinase	MAPK14	Q16539	GPS
29	S	Phosphorylation	Kinase	MAPK14	P47811	Uniprot
69	S	Phosphorylation	Kinase	DYRK2	Q5U4C9	Uniprot
120	T	Phosphorylation	Kinase	DYRK2	Q5U4C9	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
24	T	Phosphorylation	17003045
Phosphorylated at Thr-24 and Ser-29 by MAPK14, which mediates the degradation by the proteasome of EGLN3.
29	S	Phosphorylation	17003045
Phosphorylated at Ser-29 by DYRK2; this increases the ubiquitin ligase activity and promotes degradation of EGLN3 (By similarity).
29	S	Phosphorylation	17003045
Phosphorylated at Thr-24 and Ser-29 by MAPK14, which mediates the degradation by the proteasome of EGLN3.
29	S	ubiquitylation	17003045
Phosphorylated at Ser-29 by DYRK2; this increases the ubiquitin ligase activity and promotes degradation of EGLN3 (By similarity).

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SIAH2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PPARG_MOUSE	Pparg	physical	22294748

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SIAH2_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Regulation of the ring finger E3 ligase Siah2 by p38 MAPK."; Khurana A., Nakayama K., Williams S., Davis R.J., Mustelin T.,Ronai Z.; J. Biol. Chem. 281:35316-35326(2006). Cited for: PHOSPHORYLATION AT THR-24 AND SER-29, AND FUNCTION.	17003045 [Abstract]