dbPTM

SPO6_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SPO6_SCHPO
UniProt AC	Q9Y7J1
Protein Name	Sporulation-specific protein 6
Gene Name	spo6
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	474
Subcellular Localization	Nucleus .
Protein Description	May act as a kinase regulator. Essential for progression of meiosis II and sporulation..
Protein Sequence	MDFYSVKSQPFVRSPLVDQNPSIQNINEEVKRDIQNPLSYKTETSDKELCQTAACATSCSDWYPQQQTHMPHQNAFDSAKATAKMALPPTAFSNYCVKPSLTRNKDIPRTSIRVSKLRYWQRDYRLAFPNFIFYFDNVDEEIKRRVTQKINNLGAKVATLFTFEVTHFITTRTTDPEMCQPNDVLYLSKTANMKIWLLDKLLNRILFTLLNSDSLVNTSASCLQSLLDGEKVYGTSDKDFYVPSKNVEYFREYFLCIRDLSQYYKPIAVREWEKTLDSGEILWPSLAITAQGRCPFNTGRRRELKITKHNHPAHEIRKQLLSCTNQTNQNNVVKNSASVLVRQIMGDYNITESAVDGAKQMPTEFPKPENLLPVEKRAAMSPLNLLEPRLINKQNTLANQSPRQPPNAFDADPLAHKKVKIETKSGYCENCCERYKDLERHLGGKHHRRFAEKDENFQGLDDLFLLIRRPIRTN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SPO6_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SPO6_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SPO6_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SPO6_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SPO4_SCHPO	spo4	physical	11739743
ELP5_SCHPO	elp5	genetic	18818364
HIR1_SCHPO	hip1	genetic	18818364

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SPO6_SCHPO

Related Literatures of Post-Translational Modification