SNF8_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNF8_MOUSE
• UniProt AC: Q9CZ28
• Protein Name: Vacuolar-sorting protein SNF8
• Gene Name: Snf8
• Organism: Mus musculus (Mouse).
• Sequence Length: 258
• Subcellular Localization: Cytoplasm. Endosome membrane. Nucleus . Late endosome membrane. Recruited to the endosome membrane to participate in vesicle formation..
• Protein Description: Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation by participating in derepression of transcription by RNA polymerase II, possibly via its interaction with ELL. Required for degradation of both endocytosed EGF and EGFR, but not for the EGFR ligand-mediated internalization. Required for the exosomal release of SDCBP, CD63 and syndecan (By similarity)..
• Protein Sequence: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKTSLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEISAEEAKEAFP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Methylation	----MHRRGVGAGAI ----CCCCCCCHHHH	29.48	-
13	Malonylation	VGAGAIAKKKLAEAK CCHHHHHHHHHHHCH	44.31	26320211
20	Malonylation	KKKLAEAKYKERGTV HHHHHHCHHHHHCCC	48.65	26320211
134	Ubiquitination	QVLKGRGKFAQDVSQ HHHCCCCCCCCCCCH	35.84	22790023
192	Phosphorylation	QLAEKNGYVTVSEIK EEHHHCCEEEHHHHH	11.44	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SNF8_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNF8_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNF8_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VPS36_HUMAN	VPS36	physical	26496610
M3K21_HUMAN	KIAA1804	physical	26496610
ACTBL_HUMAN	ACTBL2	physical	26496610
PTAR1_HUMAN	PTAR1	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.