UniProt ID | SIRPD_HUMAN | |
---|---|---|
UniProt AC | Q9H106 | |
Protein Name | Signal-regulatory protein delta | |
Gene Name | SIRPD | |
Organism | Homo sapiens (Human). | |
Sequence Length | 197 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MPIPASPLHPPLPSLLLYLLLELAGVTHVFHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
108 | Phosphorylation | STRIREISLADAGTY HHHEEEEEHHHCCCE | 16.86 | - | |
135 | Phosphorylation | EYQSGRGTQVFVTEQ EECCCCCEEEEEECC | 21.87 | - | |
174 | N-linked_Glycosylation | LSALPERNSTNYFVQ HHHCCCCCCCCCCHH | 52.07 | UniProtKB CARBOHYD | |
196 | Phosphorylation | LGLTGLLSK------ HHHHHHHCC------ | 41.17 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIRPD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIRPD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIRPD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EPDR1_HUMAN | EPDR1 | physical | 28514442 | |
DIRA2_HUMAN | DIRAS2 | physical | 28514442 | |
HIKES_HUMAN | C11orf73 | physical | 28514442 | |
NT5C_HUMAN | NT5C | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...