UniProt ID | SGCG_HUMAN | |
---|---|---|
UniProt AC | Q13326 | |
Protein Name | Gamma-sarcoglycan | |
Gene Name | SGCG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 291 | |
Subcellular Localization |
Cell membrane, sarcolemma Single-pass type II membrane protein. Cytoplasm, cytoskeleton. |
|
Protein Description | Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.. | |
Protein Sequence | MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHNHICL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Phosphorylation | YVYKIGIYGWRKRCL EEEEEECCCHHHHHH | 12.86 | 22210691 | |
37 | Phosphorylation | GWRKRCLYLFVLLLL CHHHHHHHHHHHHHH | 11.17 | 22210691 | |
54 | Phosphorylation | LVVNLALTIWILKVM HHHHHHHHHHHHHHH | 14.52 | 22210691 | |
110 | N-linked_Glycosylation | LLLQSTQNVTVNARN HHEEEEEEEEEECCC | 31.36 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SGCG_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SGCG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SGCG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FLNC_HUMAN | FLNC | physical | 14506720 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...