SG1D2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SG1D2_HUMAN
• UniProt AC: O95969
• Protein Name: Secretoglobin family 1D member 2
• Gene Name: SCGB1D2
• Organism: Homo sapiens (Human).
• Sequence Length: 90
• Subcellular Localization: Secreted .
• Protein Description: May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones..
• Protein Sequence: MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SG1D2_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SG1D2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SG1D2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SG1D2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COEA1_HUMAN	COL14A1	physical	28514442
FSTL1_HUMAN	FSTL1	physical	28514442
MBRL_HUMAN	TMEM259	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.