dbPTM

SELM_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SELM_HUMAN
UniProt AC	Q8WWX9
Protein Name	Selenoprotein M {ECO:0000303\|PubMed:27645994}
Gene Name	SELENOM {ECO:0000303\|PubMed:27645994, ECO:0000312\|HGNC:HGNC:30397}
Organism	Homo sapiens (Human).
Sequence Length	145
Subcellular Localization	Cytoplasm, perinuclear region . Endoplasmic reticulum . Golgi apparatus . Localized to perinuclear structures corresponding to Golgi and endoplasmic reticulum.
Protein Description	May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation..
Protein Sequence	MSLLLPPLALLLLLAALVAPATAATAYRPDWNRLSGLTRARVETCGGUQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
72	Sulfoxidation	PFYHNLVMKHLPGAD HHHHHHHHHHCCCCC	2.26	30846556

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SELM_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SELM_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SELM_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SELM_HUMAN

Related Literatures of Post-Translational Modification