UniProt ID | SAPC1_HUMAN | |
---|---|---|
UniProt AC | Q5SSQ6 | |
Protein Name | Suppressor APC domain-containing protein 1 | |
Gene Name | SAPCD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGSQGSGGVPLVQAPYTVLLLPLGTSRQDPGAQSFFLWLRRMQALEREQDALWQGLELLQHGQAWFEDHLREAQRQQLHLGALGENFLTDLHSEPGRPPLAQIQKVNICLQNLIHEKELSRQQKGVTQPKEEMAQRGCTKGPRGPTRV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
139 | Phosphorylation | EMAQRGCTKGPRGPT HHHHCCCCCCCCCCC | 41.69 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SAPC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SAPC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SAPC1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CTNA2_HUMAN | CTNNA2 | physical | 26186194 | |
RHG21_HUMAN | ARHGAP21 | physical | 26186194 | |
RHG23_HUMAN | ARHGAP23 | physical | 26186194 | |
MOG1_HUMAN | RANGRF | physical | 26186194 | |
CTNB1_HUMAN | CTNNB1 | physical | 26186194 | |
RHG21_HUMAN | ARHGAP21 | physical | 28514442 | |
RHG23_HUMAN | ARHGAP23 | physical | 28514442 | |
MOG1_HUMAN | RANGRF | physical | 28514442 | |
CTNA2_HUMAN | CTNNA2 | physical | 28514442 | |
CTNB1_HUMAN | CTNNB1 | physical | 28514442 | |
CTNA1_HUMAN | CTNNA1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...