UniProt ID | S2538_HUMAN | |
---|---|---|
UniProt AC | Q96DW6 | |
Protein Name | Mitochondrial glycine transporter {ECO:0000255|HAMAP-Rule:MF_03064} | |
Gene Name | SLC25A38 {ECO:0000255|HAMAP-Rule:MF_03064} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 304 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Mitochondrial glycine transporter that imports glycine into the mitochondrial matrix. Plays an important role in providing glycine for the first enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) in the mitochondrial matrix. Required during erythropoiesis.. | |
Protein Sequence | MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQPSDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILASLVTQPADVIKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGIPRALRRTLMAAMAWTVYEEMMAKMGLKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
110 | Phosphorylation | IYFGTLYSLKQYFLR CHHHHHHHHHHHHHC | 32.00 | 24719451 | |
179 | Phosphorylation | EGHRGLFSGLTATLL CCCCCCCCCHHHHHH | 37.63 | - | |
182 | Phosphorylation | RGLFSGLTATLLRDA CCCCCCHHHHHHHCC | 22.56 | - | |
266 | Phosphorylation | VTLIFKDYGLRGFFQ HHHHHHHHCCCHHHC | 20.74 | - | |
283 | Phosphorylation | IPRALRRTLMAAMAW CCHHHHHHHHHHHHH | 17.91 | 25262027 | |
291 | Phosphorylation | LMAAMAWTVYEEMMA HHHHHHHHHHHHHHH | 12.04 | 25262027 | |
293 | Phosphorylation | AAMAWTVYEEMMAKM HHHHHHHHHHHHHHC | 9.97 | 25262027 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S2538_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S2538_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S2538_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MFN1_HUMAN | MFN1 | physical | 26813789 | |
MFN2_HUMAN | MFN2 | physical | 26813789 | |
MARH5_HUMAN | MARCH5 | physical | 26813789 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...