UniProt ID | RX21_DROME | |
---|---|---|
UniProt AC | Q24491 | |
Protein Name | RNA-binding protein Rsf1 | |
Gene Name | Rsf1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 197 | |
Subcellular Localization | Nucleus. | |
Protein Description | May control important aspects of development.. | |
Protein Sequence | MGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGSQLRVEISKGRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYSSGRSGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSPVGNHRF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
104 | Phosphorylation | RGDFGRHSITSGGSG CCCCCCCCCCCCCCC | 26.63 | 22817900 | |
106 | Phosphorylation | DFGRHSITSGGSGGG CCCCCCCCCCCCCCC | 25.08 | 18327897 | |
168 | Phosphorylation | GRDSSRYSSGSSASY CCCCCCCCCCCCCCC | 27.41 | 22817900 | |
171 | Phosphorylation | SSRYSSGSSASYGRT CCCCCCCCCCCCCCC | 25.36 | 22817900 | |
174 | Phosphorylation | YSSGSSASYGRTGGQ CCCCCCCCCCCCCCC | 30.02 | 22817900 | |
188 | Phosphorylation | QSAGRFRSRSPVGNH CCCCCCCCCCCCCCC | 34.10 | 19429919 | |
190 | Phosphorylation | AGRFRSRSPVGNHRF CCCCCCCCCCCCCCC | 25.78 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RX21_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RX21_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RX21_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SRR55_DROME | B52 | genetic | 10090730 | |
ISWI_DROME | Iswi | physical | 26549447 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-106; SER-168; SER-171;SER-174; SER-188 AND SER-190, AND MASS SPECTROMETRY. |