RWDD1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RWDD1_HUMAN
• UniProt AC: Q9H446
• Protein Name: RWD domain-containing protein 1
• Gene Name: RWDD1
• Organism: Homo sapiens (Human).
• Sequence Length: 243
• Protein Description: Protects DRG2 from proteolytic degradation..
• Protein Sequence: MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYNPADPESDSAD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MTDYGEEQR ------CCCCHHHHH	37.62	22814378
42	Ubiquitination	ITVTSEAGENDETVQ EEEEECCCCCCCCEE	30.13	29967540
59	Ubiquitination	LKFTYSEKYPDEAPL EEEEECCCCCCCCCH	57.02	22817900
61	Ubiquitination	FTYSEKYPDEAPLYE EEECCCCCCCCCHHH	43.99	21890473
61	Ubiquitination	FTYSEKYPDEAPLYE EEECCCCCCCCCHHH	43.99	21890473
70	Ubiquitination	EAPLYEIFSQENLED CCCHHHHHCCCCCCC	4.05	32015554
102	Phosphorylation	LGMVMIFTLVTAVQE HCHHHHHHHHHHHHH	14.92	30622161
105	Phosphorylation	VMIFTLVTAVQEKLN HHHHHHHHHHHHHHH	24.99	30622161
138	Ubiquitination	KEAEEAEKQLFHGTP HHHHHHHHHHHCCCC	60.39	29967540
144	Phosphorylation	EKQLFHGTPVTIENF HHHHHCCCCCCHHHH	13.15	22199227
147	Phosphorylation	LFHGTPVTIENFLNW HHCCCCCCHHHHHCC	24.63	22199227
155	Ubiquitination	IENFLNWKAKFDAEL HHHHHCCHHHCCHHH	40.40	22817900
157	Ubiquitination	NFLNWKAKFDAELLE HHHCCHHHCCHHHHH	39.80	22817900
166	Ubiquitination	DAELLEIKKKRMKEE CHHHHHHHHHHHHHH	42.75	32015554
170	Sulfoxidation	LEIKKKRMKEEEQAG HHHHHHHHHHHHHHH	9.83	30846556
182	Phosphorylation	QAGKNKLSGKQLFET HHHCCCCCHHHHHHC	45.62	29391485
232	Phosphorylation	DDEDDPDYNPADPES CCCCCCCCCCCCCCC	28.56	20068231
239	Phosphorylation	YNPADPESDSAD--- CCCCCCCCCCCC---	42.10	20068231
241	Phosphorylation	PADPESDSAD----- CCCCCCCCCC-----	43.55	20068231

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RWDD1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RWDD1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RWDD1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NUD18_HUMAN	NUDT18	physical	16189514
DRG2_HUMAN	DRG2	physical	15676025
DRG1_HUMAN	DRG1	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.