UniProt ID | RTL8A_HUMAN | |
---|---|---|
UniProt AC | Q9BWD3 | |
Protein Name | Retrotransposon Gag-like protein 8A {ECO:0000312|HGNC:HGNC:24514} | |
Gene Name | RTL8A {ECO:0000312|HGNC:HGNC:24514} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 113 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDGRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIRKESPLLNDYRGFLAEMKRVFGWEEDEDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Ubiquitination | DGRVQLMKALLAGPL CHHHHHHHHHHHCCC | 23000965 | ||
68 | Phosphorylation | DALKVTFLITRLTGP HHHHHEEEHHHHHHH | 24719451 | ||
86 | Ubiquitination | WVIPYIRKESPLLND HHHHHHHHHCCCCCC | 23000965 | ||
102 | Ubiquitination | RGFLAEMKRVFGWEE HHHHHHHHHHHCCCC | 21963094 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RTL8A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RTL8A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RTL8A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBQL1_HUMAN | UBQLN1 | physical | 16189514 | |
A4_HUMAN | APP | physical | 21832049 | |
UBQL1_HUMAN | UBQLN1 | physical | 25416956 | |
C102B_HUMAN | CCDC102B | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...