UniProt ID | RTI1_SCHPO | |
---|---|---|
UniProt AC | O42905 | |
Protein Name | DNA repair and recombination protein rti1 | |
Gene Name | rti1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 371 | |
Subcellular Localization | ||
Protein Description | Active in the repair of DNA damage and in mating-type switching. Probably involved in the repair of DNA double-strands breaks. Has a role in promoting S phase completion.. | |
Protein Sequence | MGSLPDQSSCEEFTDSQQDKMTKLLAMQLGPEYISRRSGPGGGSVTYLEAWKAIELANEIFGFNGWSSSIQDIHVDYVEETKEKKFNVGISVIVRVTLKDGSFHEDVGYGSIENCRVKALAYEKCKKEGTTDALKRALRNFGSSMGNCLYDKRYIQKILKMAPAQAEFNYDNLLRANKRPYARFAQKVSTPIESHANKSVKLEHKNSIEKKISNVDKPISDLIENDIHESLPALQNPPIQSHSETDLYADEELDSILMHHERPPIPESPRVEEFEELLNQFEGDEKVSVDKIDAHDKMTEAQVVKIPPVQFMNARVAAAENPHIKHEGMAFQLHKKSNSILKSSNIDHNRSMPIRRPSLTSNNSANTFSTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of RTI1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RTI1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RTI1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RTI1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAD22_SCHPO | rad52 | physical | 11560889 | |
RTI1_SCHPO | rti1 | physical | 11560889 | |
YC79_SCHPO | SPCC417.09c | genetic | 18818364 | |
LDH_SCHPO | SPAC186.08c | genetic | 22681890 | |
DAD1_SCHPO | dad1 | genetic | 22681890 | |
RICTR_SCHPO | ste20 | genetic | 22681890 | |
YA07_SCHPO | SPAC5H10.07 | genetic | 22681890 | |
HUS1_SCHPO | hus1 | genetic | 22681890 | |
RAD22_SCHPO | rad52 | physical | 23779158 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...