RS71_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS71_ARATH
• UniProt AC: Q9C514
• Protein Name: 40S ribosomal protein S7-1
• Gene Name: RPS7A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 191
• Protein Sequence: MFSAQHKIHKEKGVELSELDEQVAQAFFDLENTNQELKSELKDLYVNSAVQVDISGGRKAIVVNVPYRLRKAYRKIHVRLVRELEKKFSGKDVILIATRRIVRPPKKGSAAKRPRNRTLTSVHEAILDDVVLPAEIVGKRTRYRLDGTKIMKVFLDPKERNNTEYKVEAFSAVYKKLTGKDVVFEFPITEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MFSAQHKI -------CCCCHHHH	5.59	17934214
171	Phosphorylation	EYKVEAFSAVYKKLT CHHHHHHHHHHHHHH	24.71	19880383
174	Phosphorylation	VEAFSAVYKKLTGKD HHHHHHHHHHHHCCC	11.34	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS71_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS71_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS71_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUMO3_ARATH	SUMO3	physical	20855607
SUMO1_ARATH	SUMO1	physical	20855607

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.