SUMO3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SUMO3_ARATH
• UniProt AC: Q9FLP5
• Protein Name: Small ubiquitin-related modifier 3
• Gene Name: SUMO3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 111
• Subcellular Localization: Nucleus. Cytoplasm.
• Protein Description: Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process (By similarity)..
• Protein Sequence: MSNPQDDKPIDQEQEAHVILKVKSQDGDEVLFKNKKSAPLKKLMYVYCDRRGLKLDAFAFIFNGARIGGLETPDELDMEDGDVIDACRAMSGGLRANQRQWSYMLFDHNGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SUMO3_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SUMO3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SUMO3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SUMO3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EXO1_ARATH	AT1G29630	physical	24255109
CDF2_ARATH	CDF2	physical	24255109

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.