dbPTM

RPC7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RPC7_SCHPO
UniProt AC	Q8WZJ8
Protein Name	DNA-directed RNA polymerase III subunit rpc31
Gene Name	rpc31
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	210
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs..
Protein Sequence	MRRGARGSTNLGGMTWQEVLEFNANSTPTKLYPDRDIPLQRSIRPEELLELRFYKEIRTSFLDESAFYIRRNPISVVQRNEDGLVRYSDRNKPKRKNDNLSLSDLDLDPKFFPEELRKTLGAASATGRKRARRKLDMKTFIDFTIKAQDLKDESSEAAHPNIEEEPDEGLEEEDEDFGDDDDNDYGENYFDNGEGDDYDDYDGDEGAIYE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
101	Phosphorylation	KRKNDNLSLSDLDLD CCCCCCCCHHHCCCC	31.89	24763107
103	Phosphorylation	KNDNLSLSDLDLDPK CCCCCCHHHCCCCCC	32.52	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RPC7_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RPC7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RPC7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RPC7_SCHPO	rpc31	physical	26771498
YCO6_SCHPO	nap1	physical	26771498
UREG_SCHPO	SPCPB16A4.05c	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RPC7_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-103, AND MASSSPECTROMETRY.	18257517 [Abstract]