RN182_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RN182_HUMAN
• UniProt AC: Q8N6D2
• Protein Name: E3 ubiquitin-protein ligase RNF182
• Gene Name: RNF182
• Organism: Homo sapiens (Human).
• Sequence Length: 247
• Subcellular Localization: Membrane ; Multi-pass membrane protein . Cytoplasm .
• Protein Description: E3 ubiquitin-protein ligase that mediates the ubiquitination of ATP6V0C and targets it to degradation via the ubiquitin-proteasome pathway..
• Protein Sequence: MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFLDCMAPPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
111	Phosphorylation	NPTELLLTPKRLASL CCCEEEECHHHHHHH	27.08	25850435

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RN182_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RN182_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RN182_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC_HUMAN	UBC	physical	18298843
VATL_HUMAN	ATP6V0C	physical	18298843
UB2D1_HUMAN	UBE2D1	physical	18298843

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.