UniProt ID | RL13A_DROME | |
---|---|---|
UniProt AC | Q9VNE9 | |
Protein Name | 60S ribosomal protein L13a | |
Gene Name | RpL13A | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 205 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIKSYGYEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | Phosphorylation | PFHFRAPSRIFYKAV CCCCCCCCHHHHHHH | 36.70 | 27626673 | |
84 | Acetylation | APSRIFYKAVRGMIP CCCHHHHHHHHCCCC | 29.65 | 21791702 | |
189 | Acetylation | KARENIAKAAEPFNK HHHHHHHHHHHHHHH | 44.31 | 21791702 | |
196 | Acetylation | KAAEPFNKIIKSYGY HHHHHHHHHHHHCCC | 46.30 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL13A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL13A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL13A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
OR9A_DROME | Or9a | physical | 14605208 | |
SPC25_DROME | Spc25 | physical | 14605208 | |
NOL9_DROME | CG8414 | physical | 14605208 | |
EXOC2_DROME | Sec5 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...