RL13A_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL13A_DROME
• UniProt AC: Q9VNE9
• Protein Name: 60S ribosomal protein L13a
• Gene Name: RpL13A
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 205
• Protein Sequence: MTGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIKSYGYEV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	Phosphorylation	PFHFRAPSRIFYKAV CCCCCCCCHHHHHHH	36.70	27626673
84	Acetylation	APSRIFYKAVRGMIP CCCHHHHHHHHCCCC	29.65	21791702
189	Acetylation	KARENIAKAAEPFNK HHHHHHHHHHHHHHH	44.31	21791702
196	Acetylation	KAAEPFNKIIKSYGY HHHHHHHHHHHHCCC	46.30	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL13A_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL13A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL13A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
OR9A_DROME	Or9a	physical	14605208
SPC25_DROME	Spc25	physical	14605208
NOL9_DROME	CG8414	physical	14605208
EXOC2_DROME	Sec5	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.