dbPTM

RH15_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RH15_ARATH
UniProt AC	Q56XG6
Protein Name	DEAD-box ATP-dependent RNA helicase 15
Gene Name	RH15
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	427
Subcellular Localization	Nucleus . Localizes predominantly to euchromatic regions of the nucleoplasm.
Protein Description	ATP-dependent RNA helicase involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus. In addition to ssRNA and dsRNA, binds dsDNA, but not ssDNA..
Protein Sequence	MGDARDNEAYEEELLDYEEEDEKVPDSGNKVNGEAVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKELPEQIDTSTYMPS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	YEEELLDYEEEDEKV HHHHHCCCHHHHCCC	25.80	23776212
27	Phosphorylation	EDEKVPDSGNKVNGE HHCCCCCCCCCCCHH	37.89	30291188
45	Phosphorylation	KGYVGIHSSGFRDFL CCCCEECCCCCHHHH	30.18	29654922
46	Phosphorylation	GYVGIHSSGFRDFLL CCCEECCCCCHHHHC	27.99	25561503
173	Phosphorylation	CPHIVVGTPGRVLAL CCEEEEECHHHHHHH	15.80	23111157
427	Phosphorylation	DTSTYMPS------- CCCCCCCC-------	36.00	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RH15_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RH15_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RH15_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ALY2_ARATH	ALY2	physical	23555998
MOS11_ARATH	AT5G02770	physical	23555998

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RH15_ARATH

Related Literatures of Post-Translational Modification