UniProt ID | RH15_ARATH | |
---|---|---|
UniProt AC | Q56XG6 | |
Protein Name | DEAD-box ATP-dependent RNA helicase 15 | |
Gene Name | RH15 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 427 | |
Subcellular Localization | Nucleus . Localizes predominantly to euchromatic regions of the nucleoplasm. | |
Protein Description | ATP-dependent RNA helicase involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus. In addition to ssRNA and dsRNA, binds dsDNA, but not ssDNA.. | |
Protein Sequence | MGDARDNEAYEEELLDYEEEDEKVPDSGNKVNGEAVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKELPEQIDTSTYMPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | YEEELLDYEEEDEKV HHHHHCCCHHHHCCC | 25.80 | 23776212 | |
27 | Phosphorylation | EDEKVPDSGNKVNGE HHCCCCCCCCCCCHH | 37.89 | 30291188 | |
45 | Phosphorylation | KGYVGIHSSGFRDFL CCCCEECCCCCHHHH | 30.18 | 29654922 | |
46 | Phosphorylation | GYVGIHSSGFRDFLL CCCEECCCCCHHHHC | 27.99 | 25561503 | |
173 | Phosphorylation | CPHIVVGTPGRVLAL CCEEEEECHHHHHHH | 15.80 | 23111157 | |
427 | Phosphorylation | DTSTYMPS------- CCCCCCCC------- | 36.00 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RH15_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RH15_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RH15_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ALY2_ARATH | ALY2 | physical | 23555998 | |
MOS11_ARATH | AT5G02770 | physical | 23555998 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...