| UniProt ID | MOS11_ARATH | |
|---|---|---|
| UniProt AC | Q9LZ08 | |
| Protein Name | Protein MODIFIER OF SNC1 11 | |
| Gene Name | MOS11 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 214 | |
| Subcellular Localization | Nucleus, nucleoplasm . | |
| Protein Description | Contributes to the transfer of mature mRNA from the nucleus to the cytosol. May function before mRNAs enter nuclear pore and in the same mRNA export pathway as MOS3.. | |
| Protein Sequence | MATNGEKVTATVVNGGGLSTGENPKKIVDLNTTELDRTDDILDGEVKGFSDSGEKKEETDSNGIGSTAGVDSGDISPVDDIQKKIRRAERFGVSVKLTEEEKRNSRAERFGTVAAAVVNGSEGTKKAEELKRKARADRFGVPSATSTTDKTEEEAKKKARLARFGKETKVDSAEENKRKARALRFSKEASADASSDLPEKQIIGKEAAVSGSAA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 50 | Phosphorylation | DGEVKGFSDSGEKKE CCCCCCCCCCCCCCC | 23776212 | ||
| 52 | Phosphorylation | EVKGFSDSGEKKEET CCCCCCCCCCCCCCC | 30407730 | ||
| 59 | Phosphorylation | SGEKKEETDSNGIGS CCCCCCCCCCCCCCC | 23776212 | ||
| 61 | Phosphorylation | EKKEETDSNGIGSTA CCCCCCCCCCCCCCC | 23776212 | ||
| 66 | Phosphorylation | TDSNGIGSTAGVDSG CCCCCCCCCCCCCCC | 23776212 | ||
| 67 | Phosphorylation | DSNGIGSTAGVDSGD CCCCCCCCCCCCCCC | 23776212 | ||
| 72 | Phosphorylation | GSTAGVDSGDISPVD CCCCCCCCCCCCCHH | 23776212 | ||
| 76 | Phosphorylation | GVDSGDISPVDDIQK CCCCCCCCCHHHHHH | 30291188 | ||
| 190 | Phosphorylation | LRFSKEASADASSDL HHHCHHHCCCCCCCC | 30407730 | ||
| 194 | Phosphorylation | KEASADASSDLPEKQ HHHCCCCCCCCCHHH | 25561503 | ||
| 195 | Phosphorylation | EASADASSDLPEKQI HHCCCCCCCCCHHHH | 25561503 | ||
| 210 | Phosphorylation | IGKEAAVSGSAA--- CCCHHHHCCCCC--- | 29654922 | ||
| 212 | Phosphorylation | KEAAVSGSAA----- CHHHHCCCCC----- | 29654922 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOS11_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOS11_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOS11_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MOS11_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
