| UniProt ID | RGS5_HUMAN | |
|---|---|---|
| UniProt AC | O15539 | |
| Protein Name | Regulator of G-protein signaling 5 | |
| Gene Name | RGS5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 181 | |
| Subcellular Localization |
Isoform 1: Cytoplasm . Membrane . Isoform 2: Cytoplasm . |
|
| Protein Description | Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha (By similarity).. | |
| Protein Sequence | MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | GLAALPHSCLERAKE HHHCCCHHHHHHHHH | 20.61 | 28464451 | |
| 22 | Ubiquitination | RAKEIKIKLGILLQK HHHHHCHHHEEEECC | 35.34 | - | |
| 29 | Ubiquitination | KLGILLQKPDSVGDL HHEEEECCCCCCCCE | 51.25 | - | |
| 40 | Phosphorylation | VGDLVIPYNEKPEKP CCCEEECCCCCCCCC | 25.48 | 18083107 | |
| 43 | Ubiquitination | LVIPYNEKPEKPAKT EEECCCCCCCCCCCC | 55.64 | - | |
| 46 | Ubiquitination | PYNEKPEKPAKTQKT CCCCCCCCCCCCCCC | 59.82 | - | |
| 52 | Ubiquitination | EKPAKTQKTSLDEAL CCCCCCCCCCHHHHH | 45.36 | - | |
| 64 | Phosphorylation | EALQWRDSLDKLLQN HHHHHHHHHHHHHHC | 29.87 | 27535140 | |
| 67 | Ubiquitination | QWRDSLDKLLQNNYG HHHHHHHHHHHCCCC | 57.29 | - | |
| 73 | Phosphorylation | DKLLQNNYGLASFKS HHHHHCCCCHHHHHH | 22.52 | 25884760 | |
| 77 | Phosphorylation | QNNYGLASFKSFLKS HCCCCHHHHHHHHHH | 37.95 | 24719451 | |
| 79 | Ubiquitination | NYGLASFKSFLKSEF CCCHHHHHHHHHHCC | 37.49 | - | |
| 80 | Phosphorylation | YGLASFKSFLKSEFS CCHHHHHHHHHHCCC | 33.53 | 24719451 | |
| 84 | Phosphorylation | SFKSFLKSEFSEENL HHHHHHHHCCCHHHH | 46.12 | 17540411 | |
| 114 | Ubiquitination | AKMAEKAKQIYEEFI HHHHHHHHHHHHHHH | 48.58 | - | |
| 117 | Phosphorylation | AEKAKQIYEEFIQTE HHHHHHHHHHHHHCC | 13.60 | 25884760 | |
| 127 | Ubiquitination | FIQTEAPKEVNIDHF HHHCCCCCCCCCCCC | 79.80 | - | |
| 136 | Ubiquitination | VNIDHFTKDITMKNL CCCCCCCCCCCHHHC | 46.30 | - | |
| 141 | Ubiquitination | FTKDITMKNLVEPSL CCCCCCHHHCCCCCC | 38.18 | - | |
| 156 | Ubiquitination | SSFDMAQKRIHALME CHHHHHHHHHHHHHH | 43.72 | - | |
| 164 | Ubiquitination | RIHALMEKDSLPRFV HHHHHHHHCCCCHHH | 38.36 | - | |
| 166 | Phosphorylation | HALMEKDSLPRFVRS HHHHHHCCCCHHHHH | 51.87 | 17540411 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RGS5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RGS5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GNAI3_HUMAN | GNAI3 | physical | 9079700 | |
| GNAI2_HUMAN | GNAI2 | physical | 9079700 | |
| GNAO_HUMAN | GNAO1 | physical | 9079700 | |
| GNAI1_HUMAN | GNAI1 | physical | 11253162 | |
| GNAI2_HUMAN | GNAI2 | physical | 11253162 | |
| GNAI3_HUMAN | GNAI3 | physical | 11253162 | |
| GNAO_HUMAN | GNAO1 | physical | 11253162 | |
| GNAQ_HUMAN | GNAQ | physical | 11253162 | |
| A4_HUMAN | APP | physical | 21832049 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...