UniProt ID | RGS5_HUMAN | |
---|---|---|
UniProt AC | O15539 | |
Protein Name | Regulator of G-protein signaling 5 | |
Gene Name | RGS5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 181 | |
Subcellular Localization |
Isoform 1: Cytoplasm . Membrane . Isoform 2: Cytoplasm . |
|
Protein Description | Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha (By similarity).. | |
Protein Sequence | MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | GLAALPHSCLERAKE HHHCCCHHHHHHHHH | 20.61 | 28464451 | |
22 | Ubiquitination | RAKEIKIKLGILLQK HHHHHCHHHEEEECC | 35.34 | - | |
29 | Ubiquitination | KLGILLQKPDSVGDL HHEEEECCCCCCCCE | 51.25 | - | |
40 | Phosphorylation | VGDLVIPYNEKPEKP CCCEEECCCCCCCCC | 25.48 | 18083107 | |
43 | Ubiquitination | LVIPYNEKPEKPAKT EEECCCCCCCCCCCC | 55.64 | - | |
46 | Ubiquitination | PYNEKPEKPAKTQKT CCCCCCCCCCCCCCC | 59.82 | - | |
52 | Ubiquitination | EKPAKTQKTSLDEAL CCCCCCCCCCHHHHH | 45.36 | - | |
64 | Phosphorylation | EALQWRDSLDKLLQN HHHHHHHHHHHHHHC | 29.87 | 27535140 | |
67 | Ubiquitination | QWRDSLDKLLQNNYG HHHHHHHHHHHCCCC | 57.29 | - | |
73 | Phosphorylation | DKLLQNNYGLASFKS HHHHHCCCCHHHHHH | 22.52 | 25884760 | |
77 | Phosphorylation | QNNYGLASFKSFLKS HCCCCHHHHHHHHHH | 37.95 | 24719451 | |
79 | Ubiquitination | NYGLASFKSFLKSEF CCCHHHHHHHHHHCC | 37.49 | - | |
80 | Phosphorylation | YGLASFKSFLKSEFS CCHHHHHHHHHHCCC | 33.53 | 24719451 | |
84 | Phosphorylation | SFKSFLKSEFSEENL HHHHHHHHCCCHHHH | 46.12 | 17540411 | |
114 | Ubiquitination | AKMAEKAKQIYEEFI HHHHHHHHHHHHHHH | 48.58 | - | |
117 | Phosphorylation | AEKAKQIYEEFIQTE HHHHHHHHHHHHHCC | 13.60 | 25884760 | |
127 | Ubiquitination | FIQTEAPKEVNIDHF HHHCCCCCCCCCCCC | 79.80 | - | |
136 | Ubiquitination | VNIDHFTKDITMKNL CCCCCCCCCCCHHHC | 46.30 | - | |
141 | Ubiquitination | FTKDITMKNLVEPSL CCCCCCHHHCCCCCC | 38.18 | - | |
156 | Ubiquitination | SSFDMAQKRIHALME CHHHHHHHHHHHHHH | 43.72 | - | |
164 | Ubiquitination | RIHALMEKDSLPRFV HHHHHHHHCCCCHHH | 38.36 | - | |
166 | Phosphorylation | HALMEKDSLPRFVRS HHHHHHCCCCHHHHH | 51.87 | 17540411 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RGS5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RGS5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GNAI3_HUMAN | GNAI3 | physical | 9079700 | |
GNAI2_HUMAN | GNAI2 | physical | 9079700 | |
GNAO_HUMAN | GNAO1 | physical | 9079700 | |
GNAI1_HUMAN | GNAI1 | physical | 11253162 | |
GNAI2_HUMAN | GNAI2 | physical | 11253162 | |
GNAI3_HUMAN | GNAI3 | physical | 11253162 | |
GNAO_HUMAN | GNAO1 | physical | 11253162 | |
GNAQ_HUMAN | GNAQ | physical | 11253162 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...