UniProt ID | RGS13_HUMAN | |
---|---|---|
UniProt AC | O14921 | |
Protein Name | Regulator of G-protein signaling 13 | |
Gene Name | RGS13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 159 | |
Subcellular Localization | ||
Protein Description | Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to both G(i)-alpha and G(q)-alpha (By similarity).. | |
Protein Sequence | MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | SFENLMATKYGPVVY HHHHHHHHCHHHHHE | 15.72 | 22817900 | |
48 | Phosphorylation | TKYGPVVYAAYLKME HCHHHHHEEEEEECC | 5.92 | - | |
51 | Phosphorylation | GPVVYAAYLKMEHSD HHHHEEEEEECCCCC | 9.93 | - | |
142 | Ubiquitination | DSYPRFLKSEMYQKL CCCCHHHHHHHHHHH | 41.48 | - | |
146 | Phosphorylation | RFLKSEMYQKLLKTM HHHHHHHHHHHHHHH | 9.84 | - | |
148 | Ubiquitination | LKSEMYQKLLKTMQS HHHHHHHHHHHHHHH | 38.00 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
41 | T | Phosphorylation | Kinase | PRKACA | P17612 | GPS |
41 | T | Phosphorylation | Kinase | PKA-FAMILY | - | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RGS13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RGS13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GNAI2_HUMAN | GNAI2 | physical | 12193720 | |
GNA11_HUMAN | GNA11 | physical | 12193720 | |
CC140_HUMAN | CCDC140 | physical | 28514442 | |
LIN9_HUMAN | LIN9 | physical | 28514442 | |
SLAF1_HUMAN | SLAMF1 | physical | 28514442 | |
SRRT_HUMAN | SRRT | physical | 28514442 | |
CIAO1_HUMAN | CIAO1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...