RETN_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RETN_HUMAN
• UniProt AC: Q9HD89
• Protein Name: Resistin
• Gene Name: RETN
• Organism: Homo sapiens (Human).
• Sequence Length: 108
• Subcellular Localization: Secreted .
• Protein Description: Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells (By similarity). Potentially links obesity to diabetes (By similarity). Promotes chemotaxis in myeloid cells. [PubMed: 15064728]
• Protein Sequence: MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RETN_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RETN_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RETN_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RETN_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RETN_HUMAN	RETN	physical	11358969
GLI4_HUMAN	GLI4	physical	28514442
SQSTM_HUMAN	SQSTM1	physical	28514442
APEX2_HUMAN	APEX2	physical	28514442
ZN664_HUMAN	ZNF664	physical	28514442
GRP78_HUMAN	HSPA5	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.