RET1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RET1_HUMAN
• UniProt AC: P09455
• Protein Name: Retinol-binding protein 1
• Gene Name: RBP1
• Organism: Homo sapiens (Human).
• Sequence Length: 135
• Subcellular Localization: Cytoplasm . Lipid droplet .
• Protein Description: Cytoplasmic retinol-binding protein. [PubMed: 22665496]
• Protein Sequence: MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MPVDFTGYWKMLV --CCCCCCCHHHHHC	25.54	24043423
8	Phosphorylation	MPVDFTGYWKMLVNE CCCCCCCHHHHHCCC	9.98	24043423
9	Methylation	PVDFTGYWKMLVNEN CCCCCCHHHHHCCCC	4.86	-
9 (in isoform 2)	Methylation	-	4.86	24129315
9 (in isoform 3)	Methylation	-	4.86	24129315
20	Phosphorylation	VNENFEEYLRALDVN CCCCHHHHHHHCCHH	8.35	24719451
20 (in isoform 2)	Phosphorylation	-	8.35	30266825
20 (in isoform 3)	Phosphorylation	-	8.35	30266825
23	Phosphorylation	NFEEYLRALDVNVAL CHHHHHHHCCHHHHH	12.91	27251275
23 (in isoform 2)	Phosphorylation	-	12.91	30266825
23 (in isoform 3)	Phosphorylation	-	12.91	30266825
56	Phosphorylation	HMIIRTLSTFRNYIM CEEEEEHHHHHHHHH	25.53	24719451
61	Phosphorylation	TLSTFRNYIMDFQVG EHHHHHHHHHHHHCC	8.05	29759185
118	Phosphorylation	IEGDELHLEMRVEGV EECCEEEEEEEEEEE	9.64	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RET1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RET1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RET1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LRP2_HUMAN	LRP2	physical	10203351
SAP30_HUMAN	SAP30	physical	16479010
SIR2_HUMAN	SIRT2	physical	18193082
CUL4B_HUMAN	CUL4B	physical	25189618
DDB1_HUMAN	DDB1	physical	25189618

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.