UniProt ID | RASK_RAT | |
---|---|---|
UniProt AC | P08644 | |
Protein Name | GTPase KRas | |
Gene Name | Kras | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 189 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Cytoplasm, cytosol . |
|
Protein Description | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (By similarity). Plays an important role in the regulation of cell proliferation. [PubMed: 3110778 Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (By similarity] | |
Protein Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCVIM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MTEYKLVV -------CCCEEEEE | 6.07 | - | |
2 | Acetylation | ------MTEYKLVVV ------CCCEEEEEE | 48.28 | - | |
39 | Phosphorylation | YDPTIEDSYRKQVVI CCCCCCHHHCCEEEE | 17.66 | 30181290 | |
41 | Dimethylation | PTIEDSYRKQVVIDG CCCCHHHCCEEEECC | 27.21 | - | |
41 | Methylation | PTIEDSYRKQVVIDG CCCCHHHCCEEEECC | 27.21 | 4204345 | |
42 | "N6,N6-dimethyllysine" | TIEDSYRKQVVIDGE CCCHHHCCEEEECCC | 38.93 | - | |
42 | Methylation | TIEDSYRKQVVIDGE CCCHHHCCEEEECCC | 38.93 | 12692561 | |
104 | Acetylation | REQIKRVKDSEDVPM HHHHHCCCCCCCCCE | 60.62 | - | |
118 | S-nitrosocysteine | MVLVGNKCDLPSRTV EEEECCCCCCCCCCC | 8.24 | - | |
128 | Ubiquitination | PSRTVDTKQAQELAR CCCCCCHHHHHHHHH | 38.89 | - | |
180 | S-palmitoylation | KEEKTPGCVKIKKCV CCCCCCCCEEEEEEE | 2.72 | - | |
186 | Methylation | GCVKIKKCVIM---- CCEEEEEEEEC---- | 1.81 | - | |
186 | Farnesylation | GCVKIKKCVIM---- CCEEEEEEEEC---- | 1.81 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RASK_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
104 | K | Acetylation |
| - |
170 | K | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RASK_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...