| UniProt ID | RARG_MOUSE | |
|---|---|---|
| UniProt AC | P18911 | |
| Protein Name | Retinoic acid receptor gamma | |
| Gene Name | Rarg | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 458 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, acts mainly as an activator of gene expression due to weak binding to corepressors (By similarity). Required for limb bud development. In concert with RARA or RARB, required for skeletal growth, matrix homeostasis and growth plate function.. | |
| Protein Sequence | MATNKERLFAPGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSKPGPHPKASSEDEAPGGQGKRGQSPQPDQGP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Methylation | FAFPGALRGSPPFEM CCCCCHHCCCCCHHH | 42.90 | 24129315 | |
| 36 | Phosphorylation | FPGALRGSPPFEMLS CCCHHCCCCCHHHCC | 23.98 | 28066266 | |
| 43 | Phosphorylation | SPPFEMLSPSFRGLG CCCHHHCCHHHCCCC | 19.72 | 23737553 | |
| 77 | Phosphorylation | SEEMVPSSPSPPPPP CCCCCCCCCCCCCCC | 24.27 | 22817900 | |
| 79 | Phosphorylation | EMVPSSPSPPPPPRV CCCCCCCCCCCCCCC | 52.57 | 22817900 | |
| 176 | Phosphorylation | KEVKEEGSPDSYELS HHHHHCCCCCHHHCC | 28.90 | 21149613 | |
| 391 | Phosphorylation | TDLRGISTKGAERAI HHCCCCCCCCCHHEE | 31.41 | 22817900 | |
| 399 | Phosphorylation | KGAERAITLKMEIPG CCCHHEEEEEEECCC | 21.24 | 22871156 | |
| 436 | Phosphorylation | PGPHPKASSEDEAPG CCCCCCCCCCCCCCC | 40.15 | 23375375 | |
| 437 | Phosphorylation | GPHPKASSEDEAPGG CCCCCCCCCCCCCCC | 54.66 | 25263469 | |
| 447 | Acetylation | EAPGGQGKRGQSPQP CCCCCCCCCCCCCCC | 45.53 | 15628729 | |
| 451 | Phosphorylation | GQGKRGQSPQPDQGP CCCCCCCCCCCCCCC | 28.46 | 27087446 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RARG_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RARG_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RARG_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VINEX_MOUSE | Sorbs3 | physical | 15734736 | |
| TRUA_MOUSE | Pus1 | physical | 15327771 | |
| EP300_MOUSE | Ep300 | physical | 21722948 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...