RARG_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RARG_MOUSE
• UniProt AC: P18911
• Protein Name: Retinoic acid receptor gamma
• Gene Name: Rarg
• Organism: Mus musculus (Mouse).
• Sequence Length: 458
• Subcellular Localization: Nucleus .
• Protein Description: Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, acts mainly as an activator of gene expression due to weak binding to corepressors (By similarity). Required for limb bud development. In concert with RARA or RARB, required for skeletal growth, matrix homeostasis and growth plate function..
• Protein Sequence: MATNKERLFAPGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSKPGPHPKASSEDEAPGGQGKRGQSPQPDQGP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	Methylation	FAFPGALRGSPPFEM CCCCCHHCCCCCHHH	42.90	24129315
36	Phosphorylation	FPGALRGSPPFEMLS CCCHHCCCCCHHHCC	23.98	28066266
43	Phosphorylation	SPPFEMLSPSFRGLG CCCHHHCCHHHCCCC	19.72	23737553
77	Phosphorylation	SEEMVPSSPSPPPPP CCCCCCCCCCCCCCC	24.27	22817900
79	Phosphorylation	EMVPSSPSPPPPPRV CCCCCCCCCCCCCCC	52.57	22817900
176	Phosphorylation	KEVKEEGSPDSYELS HHHHHCCCCCHHHCC	28.90	21149613
391	Phosphorylation	TDLRGISTKGAERAI HHCCCCCCCCCHHEE	31.41	22817900
399	Phosphorylation	KGAERAITLKMEIPG CCCHHEEEEEEECCC	21.24	22871156
436	Phosphorylation	PGPHPKASSEDEAPG CCCCCCCCCCCCCCC	40.15	23375375
437	Phosphorylation	GPHPKASSEDEAPGG CCCCCCCCCCCCCCC	54.66	25263469
447	Acetylation	EAPGGQGKRGQSPQP CCCCCCCCCCCCCCC	45.53	15628729
451	Phosphorylation	GQGKRGQSPQPDQGP CCCCCCCCCCCCCCC	28.46	27087446

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RARG_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RARG_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RARG_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VINEX_MOUSE	Sorbs3	physical	15734736
TRUA_MOUSE	Pus1	physical	15327771
EP300_MOUSE	Ep300	physical	21722948

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.