QCR10_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: QCR10_HUMAN
• UniProt AC: O14957
• Protein Name: Cytochrome b-c1 complex subunit 10
• Gene Name: UQCR11
• Organism: Homo sapiens (Human).
• Sequence Length: 56
• Subcellular Localization: Mitochondrion inner membrane.
• Protein Description: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.; This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor..
• Protein Sequence: MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Ubiquitination	WVPYINGKFKKDN-- HHHHHCCCCCCCC--	49.90	21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of QCR10_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of QCR10_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of QCR10_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
QCR8_HUMAN	UQCRQ	physical	22939629
WNT2_HUMAN	WNT2	physical	21988832

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.